| IED ID | IndEnz0010000500 |
| Enzyme Type ID | esterase000500 |
| Protein Name |
Cutinase 4 EC 3.1.1.74 Ancut4 |
| Gene Name | cut4 ANIA_10346 |
| Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Nidulantes Emericella nidulans (Aspergillus nidulans) Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Enzyme Sequence | MPLPLLPPLLLPLEALLDLALHLVDSTGVAYSARQVTPTAPLPRLRGSSTSNDVTDNSGCKELTFIFARGTTEIGNMGTVVGPKVGEALKSLTGNKAAIQGVDYPADAAGNAALGGSGGPKMASLVETALKQCPDTKIVLGGYSQGAMVVHNAASKLSSGQVVGAVTFGDPFKSQKPDNIDQFKTFCASGDPVCLNGANVMAHLSYGNDAQTAAQFLVSAAGL |
| Enzyme Length | 223 |
| Uniprot Accession Number | C8VJF5 |
| Absorption | |
| Active Site | ACT_SITE 144; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:P00590; ACT_SITE 191; /evidence=ECO:0000250|UniProtKB:P00590; ACT_SITE 203; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:P00590 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cutin + H(2)O = cutin monomers.; EC=3.1.1.74; Evidence={ECO:0000255|RuleBase:RU361263}; |
| DNA Binding | |
| EC Number | 3.1.1.74 |
| Enzyme Function | FUNCTION: Catalyzes the hydrolysis of complex carboxylic polyesters found in the cell wall of plants (By similarity). Degrades cutin, a macromolecule that forms the structure of the plant cuticle (By similarity). Also degrades suberin, a specialized macromolecule found in the cell wall of various plant tissues (By similarity). {ECO:0000250|UniProtKB:Q5AVY9, ECO:0000250|UniProtKB:Q5B2C1}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (2); Signal peptide (1); Site (2) |
| Keywords | Disulfide bond;Hydrolase;Reference proteome;Secreted;Serine esterase;Signal |
| Interact With | |
| Induction | INDUCTION: Induced by oxidative stress, in a manner dependent on transcription factor napA. {ECO:0000269|PubMed:30863878}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000255|RuleBase:RU361263}. |
| Modified Residue | |
| Post Translational Modification | PTM: The 2 disulfide bonds play a critical role in holding the catalytic residues in juxta-position; reduction of the disulfide bridges results in the complete inactivation of the enzyme. {ECO:0000250|UniProtKB:P11373}. |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 22,699 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |