| IED ID | IndEnz0010000522 |
| Enzyme Type ID | esterase000522 |
| Protein Name |
Esterase FPSE_08126 EC 3.1.1.- Fusarium detoxification of benzoxazolinone cluster protein FPSE_08126 FDB cluster protein FPSE_08126 |
| Gene Name | FPSE_08126 |
| Organism | Fusarium pseudograminearum (strain CS3096) (Wheat and barley crown-rot fungus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Nectriaceae Fusarium Fusarium sambucinum species complex Fusarium pseudograminearum (Wheat and barley crown-rot fungus) Fusarium pseudograminearum (strain CS3096) (Wheat and barley crown-rot fungus) |
| Enzyme Sequence | MFDLDPINAAFYDQIKDLPCPHQMGGYQQAYDSLEQIQKHDAAPDIDTTTIQVGKRYGPTTVTLFRLKTLVDKPLPMVFYTHGGGWIMGSAKSFAVLMEDLARRTQAVIVFPDYTRVPHQTFPYPLEQSYEVLDYMVRHSNQHQILHGTIALAGDSVGGHMAIAMMQMSLERKLPTQIGQLVLWAPVTITYKKLGSYTTFSHAPFLTEDSMDWMIESFLPNKEDRQTALASPLTHLSDEVLAQFPPTIIFLSTVDPLLDEGVAFGHRLQKNGVDASIMKAEGQMHAFCAVKALRDGPTARAVIDLAALRLRRIFPQRDTPGHPS |
| Enzyme Length | 324 |
| Uniprot Accession Number | K3VZ29 |
| Absorption | |
| Active Site | ACT_SITE 156; /evidence=ECO:0000250|UniProtKB:O06350; ACT_SITE 255; /evidence=ECO:0000250|UniProtKB:O06350; ACT_SITE 285; /evidence=ECO:0000250|UniProtKB:O06350 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Esterase; part of the Fusarium detoxification of benzoxazolinone cluster involved in the degradation of benzoxazolinones produced by the host plant (PubMed:26296598, PubMed:25727347, PubMed:26828593). Maize, wheat, and rye produce the 2 benzoxazinone phytoanticipins 2,4-dihy-droxy-7-methoxy-1,4-benzoxazin-3-one (DIMBOA) and 2,4-dihydroxy-1,4-benzoxazin-3-one (DIBOA) that, due to their inherent instability once released, spontaneously degrade to the more stable corresponding benzoxazolinones, 6-methoxy-2-benzoxazolinone (MBOA) and 2-benzoxazolinone (BOA), respectively (By similarity). The first step in the detoxification of benzoxazolinones involves the hydrolysis of the cyclic ester bond of benzoxazolinones by the gamma-lactamase FDB1 to aminophenols (PubMed:26296598). FDB1 is able to convert 2-benzoxazolinone (BOA) into 2-aminophenol (2-AP), as well as 6-methoxy-2-benzoxazolinone (MBOA) into 5-methoxy-2-aminophenol (2-AMP) (PubMed:26296598, PubMed:25727347). The N-malonyltransferase FDB2 then metabolizes aminophenols via N-malonylation to non-toxic malonamic acids (PubMed:26296598). FDB2 converts 2-AP into N-(2-hydroxyphenyl) malonamic acid (HPMA) and 2-AMP into N-(2-hydroxy-4-methoxyphenyl) malonamic acid (HMPMA) (PubMed:26296598). The cluster contains also 2 transcription factors (FDB3 and FPSE_08121), an aldo-keto reductase (FPSE_08125) that possibly associates with a ketone component of BOA and MBOA degradation, an esterase (FPSE_08126), an acyl-CoA transferase (FPSE_08120), a solute carrier protein (FPSE_08119) and a transmembrane transporter (FPSE_08127) proposed to shuttle metabolites of benzoxazolinone degradation (Probable). {ECO:0000250|UniProtKB:W7MLD5, ECO:0000269|PubMed:25727347, ECO:0000269|PubMed:26296598, ECO:0000269|PubMed:26828593, ECO:0000305|PubMed:26828593}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase |
| Interact With | |
| Induction | INDUCTION: Expression is induced in response to 2-benzoxasolinone (BOA) exposure (PubMed:25727347). Expression is also induced in response to 6-methoxy-2-benzoxazolinone (MBOA) and 2-aminophenol (2-AP) treatment (PubMed:26828593). {ECO:0000269|PubMed:25727347, ECO:0000269|PubMed:26828593}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 36,227 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |