| IED ID | IndEnz0010000523 |
| Enzyme Type ID | esterase000523 |
| Protein Name |
Esterase FVEG_12639 EC 3.1.1.- Fusarium detoxification of benzoxazolinone cluster 2 protein FVEG_12639 FDB2 cluster protein FVEG_12639 |
| Gene Name | FVEG_12639 |
| Organism | Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Nectriaceae Fusarium Fusarium fujikuroi species complex Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides) Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides) |
| Enzyme Sequence | MVSLDPINAKFAAAIDGLPAPHQLGGPGKAFENLEELQRHEPANDIATQVIKVEGKYGPTSVTLFRSKALVDKPLPMIFYTHGGGWVMGSAKSFAVLVEDLARRTGAAVIFPDYTLAPHQTFPFPFEQSYEVLEYMIRHGKEYNLLVKTIALAGDSVGGHMAIAMMQMSLQRQLPATISQIVLWAPVTVTHKKYPSYTTFKDGPFLPEATMDWMIDTFIPSKSDRETALASPLTHLPDDVLSKFPPTIIFLSTVDPLVDEGVAFGQRLQGLGVDASVIKAEGQMHAFCLVTALRDGPTAQAVLELAALRLRKIFPDSA |
| Enzyme Length | 318 |
| Uniprot Accession Number | W7MTJ1 |
| Absorption | |
| Active Site | ACT_SITE 156; /evidence=ECO:0000250|UniProtKB:O06350; ACT_SITE 255; /evidence=ECO:0000250|UniProtKB:O06350; ACT_SITE 285; /evidence=ECO:0000250|UniProtKB:O06350 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Esterase; part of the Fusarium detoxification of benzoxazolinone cluster 2 (FDB2) involved in the degradation of benzoxazolinones produced by the host plant (PubMed:19302487, PubMed:26808652). Maize, wheat, and rye produce the 2 benzoxazinone phytoanticipins 2,4-dihy-droxy-7-methoxy-1,4-benzoxazin-3-one (DIMBOA) and 2,4-dihydroxy-1,4-benzoxazin-3-one (DIBOA) that, due to their inherent instability once released, spontaneously degrade to the more stable corresponding benzoxazolinones, 6-methoxy-2-benzoxazolinone (MBOA) and 2-benzoxazolinone (BOA), respectively (PubMed:11876429). The first step in the detoxification of benzoxazolinones involves the hydrolysis of the cyclic ester bond of benzoxazolinones by the FDB1 cluster gamma-lactamase MBL1 to aminophenols (PubMed:26808652, PubMed:12788712). MBL1 is able to convert BOA into 2-aminophenol (2-AP), as well as MBOA into 5-methoxy-2-aminophenol (2-AMP) (PubMed:26808652, PubMed:12788712). The FDB2 cluster N-malonyltransferase FDB2/NAT1 then metabolizes aminophenols via N-malonylation to non-toxic malonamic acids (PubMed:19302487, PubMed:12788712). FDB2/NAT1 converts 2-AP into N-(2-hydroxyphenyl) malonamic acid (HPMA) and 2-AMP into N-(2-hydroxy-4-methoxyphenyl) malonamic acid (HMPMA) (PubMed:19302487, PubMed:12788712). The duplicated dienlactone hydrolases DLH1 and DLH2 may provide redundant function for hydrolyzing the lactone moiety in the BOA molecule (Probable). The roles of the amidases an other enzymes encoded by the 2 FDB clusters have not been identified so far (Probable). {ECO:0000269|PubMed:11876429, ECO:0000269|PubMed:12788712, ECO:0000269|PubMed:19302487, ECO:0000269|PubMed:26808652, ECO:0000305|PubMed:26808652}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Expression is induced in response to 2-benzoxasolinone (BOA) exposure. {ECO:0000269|PubMed:26808652}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,705 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |