| IED ID | IndEnz0010000526 |
| Enzyme Type ID | esterase000526 |
| Protein Name |
Juvenile hormone esterase, isoform A JH esterase JHE-A EC 3.1.1.59 Fragments |
| Gene Name | |
| Organism | Trichoplusia ni (Cabbage looper) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Noctuoidea Noctuidae (owlet moths) Plusiinae Trichoplusia Trichoplusia ni (Cabbage looper) |
| Enzyme Sequence | LPSLSADAEAPSPLSLKADAPLAHIDSGLLGVPYAKQPIGELRVTTLRLIELPPEKLVVGAPVYLYQFSYESPSSAIKQEVVGHIEDLTYVFKGSQYQDIESPTAYQSK |
| Enzyme Length | 109 |
| Uniprot Accession Number | P30809 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + juvenile hormone I = H(+) + juvenile hormone I carboxylate + methanol; Xref=Rhea:RHEA:46916, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:83641, ChEBI:CHEBI:87109; EC=3.1.1.59; Evidence={ECO:0000250|UniProtKB:P19985}; CATALYTIC ACTIVITY: Reaction=H2O + juvenile hormone III = H(+) + juvenile hormone III carboxylate + methanol; Xref=Rhea:RHEA:46912, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:27493, ChEBI:CHEBI:83274; EC=3.1.1.59; Evidence={ECO:0000250|UniProtKB:P19985}; |
| DNA Binding | |
| EC Number | 3.1.1.59 |
| Enzyme Function | FUNCTION: JH esterase plays a crucial role in the decrease of JH activity in lepidopteran insects, by hydrolyzing the methyl ester of JH. It is also involved in the transport of JH. {ECO:0000250|UniProtKB:P19985}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (6); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Hydrolase;Reference proteome;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,814 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:46916; RHEA:46912 |
| Cross Reference Brenda |