IED ID | IndEnz0010000548 |
Enzyme Type ID | esterase000548 |
Protein Name |
Endolysin B Gene 12 protein Gp12 Mycolylarabinogalactan esterase EC 3.1.-.- |
Gene Name | 12 |
Organism | Mycobacterium phage D29 (Mycobacteriophage D29) |
Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Siphoviridae (phages with long non-contractile tails) Fromanvirus Mycobacterium phage D29 (Mycobacteriophage D29) |
Enzyme Sequence | MSKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMWPSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPTGRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEFLRQI |
Enzyme Length | 254 |
Uniprot Accession Number | O64205 |
Absorption | |
Active Site | ACT_SITE 82; /evidence="ECO:0000269|PubMed:19555454"; ACT_SITE 166; /evidence="ECO:0000305|PubMed:19555454"; ACT_SITE 240; /evidence="ECO:0000269|PubMed:19555454, ECO:0000305" |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.1.-.- |
Enzyme Function | FUNCTION: Endolysin that degrades the junction between mycolic acid and peptidoglycans in the host cell wall and participates with the holin protein in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the mycolic acid-rich outer membrane. Cleaves the ester linkage joining the mycolic acid-rich outer membrane to arabinogalactan, releasing free mycolic acids. {ECO:0000269|PubMed:19555454}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Beta strand (10); Chain (1); Helix (11); Mutagenesis (1); Turn (1) |
Keywords | 3D-structure;Antimicrobial;Bacteriolytic enzyme;Cytolysis;Host cell lysis by virus;Hydrolase;Reference proteome;Viral release from host cell |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | X-ray crystallography (1) |
Cross Reference PDB | 3HC7; |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 28,512 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |