| IED ID | IndEnz0010000572 |
| Enzyme Type ID | esterase000572 |
| Protein Name |
Lysozyme C EC 3.2.1.17 1,4-beta-N-acetylmuramidase C Asiatic softshell turtle lysozyme C ASTL |
| Gene Name | LYZ |
| Organism | Amyda cartilaginea (Asiatic softshell turtle) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Testudinata Testudines (turtles) Cryptodira (hidden-necked turtles) Trionychia Trionychidae (soft-shelled turtles) Amyda Amyda cartilaginea (Asiatic softshell turtle) |
| Enzyme Sequence | KIYEQCEAAREMKRLGLDGYDGYSLGDWVCTAKHESNFNTGATNYNRGDQSTDYGIFQINSRWWCNDGKTPNAKNACGIECSELLKADITAAVICAKRVVRDPNGMGAWVAWTKYCKGKDVSQWIKGCKL |
| Enzyme Length | 130 |
| Uniprot Accession Number | P85345 |
| Absorption | |
| Active Site | ACT_SITE 35; /evidence="ECO:0000250|UniProtKB:P00702, ECO:0000255|PROSITE-ProRule:PRU00680"; ACT_SITE 53; /evidence="ECO:0000250|UniProtKB:P00702, ECO:0000255|PROSITE-ProRule:PRU00680" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.; EC=3.2.1.17; Evidence={ECO:0000269|PubMed:16549391}; |
| DNA Binding | |
| EC Number | 3.2.1.17 |
| Enzyme Function | FUNCTION: Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has strong bacteriolytic activity against M.luteus and V.cholerae, weak bacteriolytic activity against P.aeruginosa and no activity against A.hydrophila. {ECO:0000255|PROSITE-ProRule:PRU00680, ECO:0000269|PubMed:16549391}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 40 degrees Celsius. Retains the bulk of its activity after incubation for 1 hour at 90 degrees Celsius. {ECO:0000269|PubMed:16549391}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.0. {ECO:0000269|PubMed:16549391}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (4); Domain (1) |
| Keywords | Antimicrobial;Bacteriolytic enzyme;Direct protein sequencing;Disulfide bond;Glycosidase;Hydrolase;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,543 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |