| IED ID | IndEnz0010000611 |
| Enzyme Type ID | esterase000611 |
| Protein Name |
Lysozyme C EC 3.2.1.17 1,4-beta-N-acetylmuramidase C |
| Gene Name | |
| Organism | Paralichthys olivaceus (Bastard halibut) (Hippoglossus olivaceus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Neoteleostei Eurypterygia Ctenosquamata Acanthomorphata Euacanthomorphacea Percomorphaceae Carangaria Pleuronectiformes (flatfishes) Pleuronectoidei Paralichthyidae (large-tooth flounders) Paralichthys Paralichthys olivaceus (Bastard halibut) (Hippoglossus olivaceus) |
| Enzyme Sequence | MRTLVVLLLVAVANARVYERCEWARLLRNQGMDGYRGISLANWVCLTEWESHYNTRATNHNTDGSTDYGIFQINSRWWCNDSQTPTSNACNIRCSELLTDDVIVAIKCAKRVVRDPNGIGAWVAWRQHCQGQDLSSYLAGCGL |
| Enzyme Length | 143 |
| Uniprot Accession Number | Q9DD65 |
| Absorption | |
| Active Site | ACT_SITE 50; /evidence=ECO:0000255|PROSITE-ProRule:PRU00680; ACT_SITE 67; /evidence=ECO:0000255|PROSITE-ProRule:PRU00680 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.; EC=3.2.1.17; |
| DNA Binding | |
| EC Number | 3.2.1.17 |
| Enzyme Function | FUNCTION: Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. {ECO:0000255|PROSITE-ProRule:PRU00680}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (4); Domain (1); Glycosylation (1); Signal peptide (1) |
| Keywords | Antimicrobial;Bacteriolytic enzyme;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..15; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,169 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |