| IED ID | IndEnz0010000613 |
| Enzyme Type ID | esterase000613 |
| Protein Name |
Lysozyme C EC 3.2.1.17 1,4-beta-N-acetylmuramidase C Softshell turtle lysozyme C SSTL |
| Gene Name | LYZ |
| Organism | Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Testudinata Testudines (turtles) Cryptodira (hidden-necked turtles) Trionychia Trionychidae (soft-shelled turtles) Pelodiscus Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis) |
| Enzyme Sequence | GKIYEQCELAREFKRHGMDGYHGYSLGDWVCTAKHESNFNTAATNYNRGDQSTDYGILQINSRWWCNDGKTPKAKNACGIECSELLKADITAAVNCAKRIVRDPNGMGAWVAWTKYCKGKDVSQWIKGCKL |
| Enzyme Length | 131 |
| Uniprot Accession Number | Q7LZQ1 |
| Absorption | |
| Active Site | ACT_SITE 36; /evidence=ECO:0000255|PROSITE-ProRule:PRU00680; ACT_SITE 54; /evidence=ECO:0000255|PROSITE-ProRule:PRU00680 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.; EC=3.2.1.17; Evidence={ECO:0000269|PubMed:16549391}; |
| DNA Binding | |
| EC Number | 3.2.1.17 |
| Enzyme Function | FUNCTION: Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has strong bacteriolytic activity against M.luteus and V.cholerae, weak bacteriolytic activity against P.aeruginosa and no activity against A.hydrophila. {ECO:0000255|PROSITE-ProRule:PRU00680, ECO:0000269|PubMed:16549391}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 40 degrees Celsius. Activity rapidly decreases within 30 minutes of incubation at 90 degrees Celsius. {ECO:0000269|PubMed:16549391}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.0. {ECO:0000269|PubMed:16549391}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (2); Chain (1); Disulfide bond (4); Domain (1); Helix (8); Turn (5) |
| Keywords | 3D-structure;Antimicrobial;Bacteriolytic enzyme;Direct protein sequencing;Disulfide bond;Glycosidase;Hydrolase;Reference proteome;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 2GV0; |
| Mapped Pubmed ID | 8061608; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,732 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.2.1.17; |