| IED ID | IndEnz0010000619 |
| Enzyme Type ID | esterase000619 |
| Protein Name |
Lysozyme C EC 3.2.1.17 1,4-beta-N-acetylmuramidase C Fragment |
| Gene Name | LYZ |
| Organism | Pseudocheirus peregrinus (Common ring-tailed possum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Metatheria Diprotodontia Pseudocheiridae (ring-tailed possums) Pseudocheirus Pseudocheirus peregrinus (Common ring-tailed possum) |
| Enzyme Sequence | SKMKKCEFAKIAKEQHMDGYHGVSLADWVCLVNNESDFNTKAINRNKGI |
| Enzyme Length | 49 |
| Uniprot Accession Number | P21776 |
| Absorption | |
| Active Site | ACT_SITE 35; /evidence=ECO:0000255|PROSITE-ProRule:PRU00680 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.; EC=3.2.1.17; |
| DNA Binding | |
| EC Number | 3.2.1.17 |
| Enzyme Function | FUNCTION: Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Non-terminal residue (1) |
| Keywords | Antimicrobial;Bacteriolytic enzyme;Direct protein sequencing;Glycosidase;Hydrolase;Milk protein;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,570 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |