| IED ID | IndEnz0010000639 |
| Enzyme Type ID | esterase000639 |
| Protein Name |
Lissencephaly-1 homolog A Platelet-activating factor acetylhydrolase IB subunit alpha a |
| Gene Name | pafah1b1a lis1b si:dkey-95O3.1 |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio) |
| Enzyme Sequence | MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEINIGGPIGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDHETGDFERTLKGHTDSVQDISFDHTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLIASSSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGVLVHPGGKYIVSCADDKTLRIWDYKNKRCTKTLSAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR |
| Enzyme Length | 410 |
| Uniprot Accession Number | Q7T394 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Regulatory subunit (beta subunit) of the cytosolic type I platelet-activating factor (PAF) acetylhydrolase (PAF-AH (I)), an enzyme that catalyzes the hydrolyze of the acetyl group at the sn-2 position of PAF and its analogs and participates in PAF inactivation. Regulates the PAF-AH (I) activity in a catalytic dimer composition-dependent manner (By similarity). Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the peripheral transport of microtubule fragments and the coupling of the nucleus and centrosome. May be required for proliferation of neuronal precursors and neuronal migration. {ECO:0000250|UniProtKB:P43033, ECO:0000255|HAMAP-Rule:MF_03141}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Coiled coil (1); Domain (1); Initiator methionine (1); Repeat (7) |
| Keywords | Cell cycle;Cell division;Coiled coil;Cytoplasm;Cytoskeleton;Developmental protein;Differentiation;Microtubule;Mitosis;Neurogenesis;Reference proteome;Repeat;Transport;WD repeat |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000255|HAMAP-Rule:MF_03141}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000255|HAMAP-Rule:MF_03141}. Note=Localizes to the plus end of microtubules and to the centrosome. {ECO:0000255|HAMAP-Rule:MF_03141}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 19657569; 19822223; |
| Motif | |
| Gene Encoded By | |
| Mass | 46,513 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |