| IED ID | IndEnz0010000715 |
| Enzyme Type ID | esterase000715 |
| Protein Name |
Cephalosporin-C deacetylase EC 3.1.1.41 Acetylxylan esterase EC 3.1.1.72 |
| Gene Name | cah BSU03180 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG |
| Enzyme Length | 318 |
| Uniprot Accession Number | P94388 |
| Absorption | |
| Active Site | ACT_SITE 181; /note=Nucleophile; ACT_SITE 269; /note=Charge relay system; ACT_SITE 298; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | BINDING 91; /note=Substrate; via amide nitrogen |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Deacetylation of xylans and xylo-oligosaccharides.; EC=3.1.1.72; Evidence={ECO:0000269|PubMed:12842474}; CATALYTIC ACTIVITY: Reaction=cephalosporin C + H2O = acetate + deacetylcephalosporin C + H(+); Xref=Rhea:RHEA:22596, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30089, ChEBI:CHEBI:57511, ChEBI:CHEBI:58366; EC=3.1.1.41; Evidence={ECO:0000269|PubMed:12842474}; |
| DNA Binding | |
| EC Number | 3.1.1.41; 3.1.1.72 |
| Enzyme Function | FUNCTION: Esterase that removed acetyl groups from a number of O-acetylated small substrates, such as acetylated xylose, short xylooligosaccharides and cephalosporin C. Has no activity towards polymeric acetylated xylan. Cannot cleave amide linkages. {ECO:0000269|PubMed:12842474}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (13); Binding site (1); Chain (1); Helix (14); Mutagenesis (1); Turn (4) |
| Keywords | 3D-structure;Carbohydrate metabolism;Cellulose degradation;Cytoplasm;Hydrolase;Polysaccharide degradation;Reference proteome;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1L7A; 1ODS; 1ODT; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,807 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:22596 |
| Cross Reference Brenda | 3.1.1.41; |