| IED ID | IndEnz0010000723 |
| Enzyme Type ID | esterase000723 |
| Protein Name |
Strigolactone esterase D14 EC 3.1.-.- Protein DWARF 14 Protein DWARF 88 Protein HIGH-TILLERING DWARF 2 |
| Gene Name | D14 D88 HTD2 Os03g0203200 LOC_Os03g10620 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MLRSTHPPPSSPSSSSSGGGGGGGSSASSSSEKTMVGGGGGGGGGSGSAAPSGAKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY |
| Enzyme Length | 318 |
| Uniprot Accession Number | Q10QA5 |
| Absorption | |
| Active Site | ACT_SITE 147; /note=Nucleophile; /evidence=ECO:0000269|PubMed:24336200; ACT_SITE 268; /evidence=ECO:0000269|PubMed:24336200; ACT_SITE 297; /evidence=ECO:0000269|PubMed:24336200 |
| Activity Regulation | |
| Binding Site | BINDING 147; /note=Substrate; /evidence=ECO:0000269|PubMed:26470846; BINDING 241; /note=Substrate; /evidence=ECO:0000269|PubMed:26470846; BINDING 297; /note=Substrate; /evidence=ECO:0000269|PubMed:26470846 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Involved in strigolactone (SL) signaling pathway. May function downstream of SL synthesis, as a component of hormone signaling or as an enzyme that participates in the conversion of SL to the bioactive form. Strigolactones are hormones that inhibit tillering and shoot branching through the MAX-dependent pathway, contribute to the regulation of shoot architectural response to phosphate-limiting conditions and function as rhizosphere signal that stimulates hyphal branching of arbuscular mycorrhizal fungi and trigger seed germination of root parasitic weeds (PubMed:19579033, PubMed:19542179, PubMed:23301669). Strigolactone-dependent association of D14 with D3 and D53 (a repressor of SL signaling) triggers D53 ubiquitination and degradation (PubMed:24336200, PubMed:24616269). Hydrolyzes the butenolide ring of SLs (PubMed:23381136, PubMed:24131983). A reaction product D-OH is trapped in the cavity of D14, inducing the interaction with SLR1, and probably with other proteins such as D3 and D53 (PubMed:24131983). Contributes to the negative regulation of gibberellin signaling (PubMed:24131983). {ECO:0000269|PubMed:19542179, ECO:0000269|PubMed:19579033, ECO:0000269|PubMed:23301669, ECO:0000269|PubMed:23381136, ECO:0000269|PubMed:24131983, ECO:0000269|PubMed:24336200, ECO:0000269|PubMed:24616269}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (7); Binding site (3); Chain (1); Compositional bias (1); Helix (15); Mutagenesis (9); Region (1); Turn (3) |
| Keywords | 3D-structure;Cytoplasm;Hydrolase;Nucleus;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:24131983}. Nucleus {ECO:0000269|PubMed:24131983, ECO:0000269|PubMed:24616269}. Note=The interaction between D14 and SLR1 takes place in the nucleus (PubMed:24131983). The interaction between D14 and D3 takes place in the nucleus (PubMed:24616269). {ECO:0000269|PubMed:24131983, ECO:0000269|PubMed:24616269}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (14) |
| Cross Reference PDB | 3VXK; 3W04; 3W05; 3WIO; 4IH9; 4IHA; 5DJ5; 5YZ7; 5ZHR; 5ZHS; 5ZHT; 6AP8; 6BRT; 6ELX; |
| Mapped Pubmed ID | 22959345; 29394369; 29523686; 29727000; 30391752; |
| Motif | |
| Gene Encoded By | |
| Mass | 33,508 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |