| IED ID | IndEnz0010000786 |
| Enzyme Type ID | esterase000786 |
| Protein Name |
Esterase PE11 EC 3.1.1.6 PE family protein PE11 |
| Gene Name | PE11 lipX Rv1169c |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MSFVTTRPDSIGETAANLHEIGVTMSAHDDGVTPLITNVESPAHDLVSIVTSMLFSMHGELYKAIARQAHVIHESFVQTLQTSKTSYWLTELANRAGTST |
| Enzyme Length | 100 |
| Uniprot Accession Number | Q79FR5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=an acetyl ester + H2O = acetate + an aliphatic alcohol + H(+); Xref=Rhea:RHEA:12957, ChEBI:CHEBI:2571, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30089, ChEBI:CHEBI:47622; EC=3.1.1.6; Evidence={ECO:0000269|PubMed:26902658}; CATALYTIC ACTIVITY: Reaction=a butanoate ester + H2O = an aliphatic alcohol + butanoate + H(+); Xref=Rhea:RHEA:47348, ChEBI:CHEBI:2571, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17968, ChEBI:CHEBI:50477; Evidence={ECO:0000269|PubMed:26902658}; CATALYTIC ACTIVITY: Reaction=an octanoate ester + H2O = an aliphatic alcohol + H(+) + octanoate; Xref=Rhea:RHEA:47356, ChEBI:CHEBI:2571, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:25646, ChEBI:CHEBI:87657; Evidence={ECO:0000269|PubMed:26902658}; |
| DNA Binding | |
| EC Number | 3.1.1.6 |
| Enzyme Function | FUNCTION: Involved in cell wall lipids remodeling and in virulence (PubMed:26157429, PubMed:26902658, PubMed:28198348). Restricts the biofilm growth and is essential for the optimal intracellular survival of M.tuberculosis (PubMed:28198348). Shows esterase activity with a preference for short-chain esters, particularly pNP-acetate (C2) and pNP-butyrate (C4) (PubMed:26902658). Has weaker activity with pNP-octanoate (C8), pNP-laurate (C12) and pNP-myristate (C14) (PubMed:26902658). Shows weak long-chain triacylglycerol (TAG) hydrolase activity in vitro (PubMed:16354661). Not necessary for PPE17 stability or for its localization on the mycobacterial surface (PubMed:23469198). {ECO:0000269|PubMed:16354661, ECO:0000269|PubMed:23469198, ECO:0000269|PubMed:26157429, ECO:0000269|PubMed:26902658, ECO:0000269|PubMed:28198348}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1) |
| Keywords | Cell wall;Cell wall biogenesis/degradation;Hydrolase;Reference proteome;Secreted;Virulence |
| Interact With | |
| Induction | INDUCTION: Coexpressed with PPE17. {ECO:0000269|PubMed:23469198, ECO:0000269|PubMed:28198348}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000269|PubMed:26157429}. Note=Cell wall associated protein. {ECO:0000269|PubMed:26157429}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,872 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:12957; RHEA:47348; RHEA:47356 |
| Cross Reference Brenda |