| IED ID | IndEnz0010000807 |
| Enzyme Type ID | esterase000807 |
| Protein Name |
CRISPR-associated endonuclease Cas3-HD EC 3.1.-.- |
| Gene Name | cas3 cas3'' SSO2001 |
| Organism | Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) |
| Taxonomic Lineage | cellular organisms Archaea TACK group Crenarchaeota Thermoprotei Sulfolobales Sulfolobaceae Saccharolobus Saccharolobus solfataricus (Sulfolobus solfataricus) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) |
| Enzyme Sequence | MIKPCAYEKQGLIDHAIGSYRVLDGKISESYYKIISRRLERYGIVLDLNGVKEMVKDVVVLHDMGKAGEYYQNQFDDNCNPLKSNFSFIYHELGSALFFYYDYEPIDVEKAEEVKSLLTLAVLNHLNAIRVISDYLVNKFPDNFDERMIKLNKYGSIMLQNLRGVISKSLKVRDYTFDDYHDMLYAFSKKSDKYLKLYNLFLAPIMLGDNLDSSLVRNNGSKTGFVRILEGELNGGSTL |
| Enzyme Length | 239 |
| Uniprot Accession Number | Q97WW0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Cas3 plus Cascade participate in CRISPR interference, the third stage of CRISPR immunity. Acts as a dsDNA and dsRNA endonuclease (in a fusion with Alicyclus caldarius esterase to increase solubility). {ECO:0000269|PubMed:19174159}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 50 degrees Celsius. Expressed as a fusion protein to increase stability. {ECO:0000269|PubMed:19174159}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 3 and 7-8. Expressed as a fusion protein to increase stability. {ECO:0000269|PubMed:19174159}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Metal binding (2); Mutagenesis (3) |
| Keywords | Antiviral defense;Endonuclease;Hydrolase;Magnesium;Metal-binding;Nuclease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,515 |
| Kinetics | |
| Metal Binding | METAL 63; /note=Magnesium; /evidence=ECO:0000250; METAL 92; /note=Magnesium; /evidence=ECO:0000255 |
| Rhea ID | |
| Cross Reference Brenda | 3.1.99.B5; |