| IED ID | IndEnz0010000810 |
| Enzyme Type ID | esterase000810 |
| Protein Name |
Probable carboxylesterase Culp2 EC 3.1.1.- Cutinase-like protein 2 Culp2 |
| Gene Name | cut2 BQ2027_MB2323 |
| Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium bovis Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Enzyme Sequence | MNDLLTRRLLTMGAAAAMLAAVLLLTPITVPAGYPGAVAPATAACPDAEVVFARGRFEPPGIGTVGNAFVSALRSKVNKNVGVYAVKYPADNQIDVGANDMSAHIQSMANSCPNTRLVPGGYSLGAAVTDVVLAVPTQMWGFTNPLPPGSDEHIAAVALFGNGSQWVGPITNFSPAYNDRTIELCHGDDPVCHPADPNTWEANWPQHLAGAYVSSGMVNQAADFVAGKLQ |
| Enzyme Length | 230 |
| Uniprot Accession Number | P63882 |
| Absorption | |
| Active Site | ACT_SITE 123; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O53581; ACT_SITE 189; /evidence=ECO:0000250|UniProtKB:O53581; ACT_SITE 207; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:O53581 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (2); Signal peptide (1) |
| Keywords | Disulfide bond;Hydrolase;Secreted;Serine esterase;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P9WP41}. Cell surface {ECO:0000250|UniProtKB:P9WP41}. |
| Modified Residue | |
| Post Translational Modification | PTM: Predicted to be exported by the Tat system. The position of the signal peptide cleavage has not been experimentally proven. {ECO:0000255|PROSITE-ProRule:PRU00648}. |
| Signal Peptide | SIGNAL 1..32; /note=Tat-type signal; /evidence=ECO:0000255|PROSITE-ProRule:PRU00648 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,926 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |