| IED ID | IndEnz0010000854 |
| Enzyme Type ID | esterase000854 |
| Protein Name |
Probable feruloyl esterase C EC 3.1.1.73 Ferulic acid esterase C |
| Gene Name | faeC AFUA_2G14530 |
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Enzyme Sequence | MVPTIIYSAILALSAFTPSVFAQTRSSGCGKQPSLANGVHNINGREYILKVPDNYDKNKAHHLVFGLHWRGGNMWNIVDGQSIQPWYGLETRAQGSAIFVAPNGKNAGWANYGGEDIAFIDAIIKQVESDLCVDQSSRFATGFSWGGGMSYSLACSRAKQFKAVSVLSGGVISGCDGGNDPIAYLGIHGINDGVLPFQGGVNLAQKFVRNNGCQQSNVGTPQPGSRGSVRTDFKGCSKPVSFIAYDGGHDAAPLGVGSSLAPDATWRFFMAA |
| Enzyme Length | 272 |
| Uniprot Accession Number | A4D9B6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Feruloyl-polysaccharide + H(2)O = ferulate + polysaccharide.; EC=3.1.1.73; |
| DNA Binding | |
| EC Number | 3.1.1.73 |
| Enzyme Function | FUNCTION: Involved in degradation of plant cell walls. Hydrolyzes the feruloyl-arabinose ester bond in arabinoxylans, and the feruloyl-galactose ester bond in pectin. Active against paranitrophenyl-acetate, methyl ferulate and wheat arabinoxylan (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Serine esterase;Signal;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,770 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |