| IED ID | IndEnz0010000964 |
| Enzyme Type ID | esterase000964 |
| Protein Name |
Growth-blocking peptide, long form GBP Cleaved into: Growth-blocking peptide, short form |
| Gene Name | |
| Organism | Mythimna separata (Oriental armyworm) (Pseudaletia separata) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Noctuoidea Noctuidae (owlet moths) Hadeninae Mythimna Mythimna separata (Oriental armyworm) (Pseudaletia separata) |
| Enzyme Sequence | MKLTISILFCVILTLQYNGADGKLKDLFGKIHDSVHGTADKVKEDLNSLFHPNDKNQQGNNDASSNIHFADSEENTDAAKKPDEVTPATTTTTTAAPAVPNAPSDNPTTLAPSTTTKDGRENFSGGCVAGYMRTPDGRCKPTFYQ |
| Enzyme Length | 145 |
| Uniprot Accession Number | Q27913 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Biogenic peptide that prevents the onset of metamorphosis from larva to pupa. Has repressive activity against juvenile hormone esterase. Induces cell proliferation at low concentrations and inhibits it at high concentrations. Mediates the spreading of plasmatocytes to foreign surfaces. May have a role in the regulation of dopamine concentrations. {ECO:0000269|PubMed:10928276, ECO:0000269|PubMed:11429413, ECO:0000269|PubMed:9753606}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Compositional bias (2); Disulfide bond (1); Modified residue (1); Mutagenesis (8); Peptide (2); Propeptide (1); Region (1); Signal peptide (1) |
| Keywords | 3D-structure;Amidation;Cytokine;Direct protein sequencing;Disulfide bond;Mitogen;Signal |
| Interact With | |
| Induction | INDUCTION: By parasitization and low temperatures. {ECO:0000269|PubMed:10928276, ECO:0000269|PubMed:8580912}. |
| Subcellular Location | |
| Modified Residue | MOD_RES 145; /note=Glutamine amide; /evidence=ECO:0000250 |
| Post Translational Modification | PTM: Growth-blocking peptide appears to exist in two different forms, a long form which has been isolated from parasitized larvae and a short form which is found in non-parasitized larvae. The stop codon of the short form may be read as a Tyr to synthesize the long form. |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | NMR spectroscopy (4) |
| Cross Reference PDB | 1BQF; 2EQH; 2EQQ; 2EQT; |
| Mapped Pubmed ID | 19710009; |
| Motif | |
| Gene Encoded By | |
| Mass | 15,547 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |