| IED ID | IndEnz0010000992 |
| Enzyme Type ID | esterase000992 |
| Protein Name |
Esterase mokD EC 3.1.2.31 Monacolin K biosynthesis protein D |
| Gene Name | mokD |
| Organism | Monascus pilosus (Red mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Monascus Monascus pilosus (Red mold) |
| Enzyme Sequence | MRIQRTPAPPKAPRALLCVHGAGCSPAIFRVQLSKLRAALREDFEFVYATAPFPSAPGPGILPTFEGLGPYYTWFEGSPSGAAAKGDNSNSNDSNSSPTVHDRLAAVHEPVRRAIAEWQTQNPSIPIVGTVSFSEGALVTALLLWQQQMGRIPWLPVMQVAMFICCWYQHEATQYMREEVGCGGDGGIDGEKLVIRGVLSLHLQGRDDFALAGSKMVVAQHFVPGEAQVLEFAGRHHFPNRPRDVLETVKRFRQLCVRARVIG |
| Enzyme Length | 263 |
| Uniprot Accession Number | Q3S2U0 |
| Absorption | |
| Active Site | ACT_SITE 134; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 208; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 236; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=dihydromonacolin L-[lovastatin nonaketide synthase] + H2O = dihydromonacolin L carboxylate + H(+) + holo-[lovastatin nonaketide synthase]; Xref=Rhea:RHEA:11592, Rhea:RHEA-COMP:10042, Rhea:RHEA-COMP:10043, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:64479, ChEBI:CHEBI:79031, ChEBI:CHEBI:79032; EC=3.1.2.31; Evidence={ECO:0000250|UniProtKB:Q0C8M2}; |
| DNA Binding | |
| EC Number | 3.1.2.31 |
| Enzyme Function | FUNCTION: Esterase; part of the gene cluster that mediates the biosynthesis of monakolin K, also known as lovastatin, and which acts as a potent competitive inhibitor of HMG-CoA reductase (PubMed:18578535). Monakolin K biosynthesis is performed in two stages (PubMed:19693441). The first stage is catalyzed by the nonaketide synthase mokA, which belongs to type I polyketide synthases and catalyzes the iterative nine-step formation of the polyketide (PubMed:18578535, PubMed:19693441). This PKS stage completed by the action of dehydrogenase mokE, which catalyzes the NADPH-dependent reduction of the unsaturated tetra-, penta- and heptaketide intermediates that arise during the mokA-mediated biosynthesis of the nonaketide chain and leads to dihydromonacolin L (PubMed:19693441). Covalently bound dihydromonacolin L is released from mokA by the mokD esterase (By similarity). Conversion of dihydromonacolin L into monacolin L and then monacolin J is subsequently performed with the participation of molecular oxygen and P450 monoogygenase mokC (PubMed:19693441). Finally, mokF performs the conversion of monacoline J to monacoline K through the addition of the side-chain diketide moiety (2R)-2-methylbutanoate produced by the diketide synthase mokB (PubMed:19693441). {ECO:0000250|UniProtKB:Q0C8M2, ECO:0000269|PubMed:19693441, ECO:0000303|PubMed:18578535}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Polyketide biosynthesis; lovastatin biosynthesis. {ECO:0000250|UniProtKB:Q0C8M2}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase |
| Interact With | |
| Induction | INDUCTION: Expression is controlled by the monacolin K cluster transcription regulator mokH (PubMed:19968298). {ECO:0000269|PubMed:19968298}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,843 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:11592 |
| Cross Reference Brenda |