| IED ID | IndEnz0010001007 |
| Enzyme Type ID | esterase001007 |
| Protein Name |
Methylesterase 17 AtMES17 EC 3.1.1.- Methyl indole-3-acetic acid esterase |
| Gene Name | MES17 At3g10870 T7M13.5 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAEENQEETLELKPSRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDSSSVDSLTTFDQYNQPLIDFLSSFPEQEQVILVGHSAGGLSLTSAIQRFPKKICLAVFIGASMLKNGLQTDEDMKDGVPDLSEHGDVYELGFGLGPENPPTSAIIKPEYRRKLLYHMSPQQECSLAALMMRPAPILALTTAKLEEEEKEKGQEEQVPRVYIKTLLDRVMKPEQQDAMIRRWPPSQVYELESDHSPFFSNPFVLFGLLIKAAVSVGSI |
| Enzyme Length | 276 |
| Uniprot Accession Number | Q9SG92 |
| Absorption | |
| Active Site | ACT_SITE 95; /note=Acyl-ester intermediate; /evidence=ECO:0000250|UniProtKB:Q6RYA0; ACT_SITE 225; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q6RYA0; ACT_SITE 252; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q6RYA0 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + methyl (indol-3-yl)acetate = (indol-3-yl)acetate + H(+) + methanol; Xref=Rhea:RHEA:32919, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:30854, ChEBI:CHEBI:72782; Evidence={ECO:0000269|PubMed:18467465};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:32920; Evidence={ECO:0000269|PubMed:18467465}; |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Methylesterase that efficiently and specifically hydrolyzes methyl indole-3-acetic acid (MeIAA) to IAA (auxin). MeIAA is believed to be an inactive form of auxin that needs to be demethylated to exert a biological effect. {ECO:0000269|PubMed:18467465}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Plant hormone biosynthesis. {ECO:0000269|PubMed:18467465}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Domain (1) |
| Keywords | Hydrolase;Reference proteome |
| Interact With | Q9MAA7; Q9LYC1 |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16648215; 18643994; 18805951; 20226671; 24665109; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,868 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=13 uM for methyl indole-3-acetic acid (MeIAA) (at pH 7.5) {ECO:0000269|PubMed:18467465}; Note=kcat is 0.18 sec(-1) with methyl indole-3-acetic acid as substrate. {ECO:0000269|PubMed:18467465}; |
| Metal Binding | |
| Rhea ID | RHEA:32919; RHEA:32920 |
| Cross Reference Brenda | 3.1.1.1; |