| IED ID | IndEnz0010001046 |
| Enzyme Type ID | esterase001046 |
| Protein Name |
Esterase OVCA2 EC 3.1.2.- Ovarian cancer-associated gene 2 protein homolog |
| Gene Name | Ovca2 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAARQTLRVLCLAGFRQSERGFREKTGALRKTLRGRAELVCLSGPHPVPEAAAPEGSCPDSGPCSPEEQPRGWWFSEEEADVFSALEESTVCRGLQEALETVARALDTLGPFDGLLGFSQGAALAAYVCALGQAGDPRFPLPRFIILVSGFCPRGLKEPILQSPMSLPSLHVFGDTDRVIPSQESMQLASRFLGAVTLTHSGGHFIPAAASQRQAYLKFLDQFAE |
| Enzyme Length | 225 |
| Uniprot Accession Number | Q9D7E3 |
| Absorption | |
| Active Site | ACT_SITE 119; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 177; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 204; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.2.- |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12466851; 14610273; 21267068; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,246 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |