| IED ID | IndEnz0010001056 |
| Enzyme Type ID | esterase001056 |
| Protein Name |
Alpha-hydroxynitrile lyase AtHNL EC 4.1.2.10 R -hydroxynitrile lyase R -oxynitrilase Methylesterase 5 AtMES5 |
| Gene Name | HNL MES5 At5g10300 F18D22_70 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MERKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQAVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMGPKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSLSAIATDYM |
| Enzyme Length | 258 |
| Uniprot Accession Number | Q9LFT6 |
| Absorption | |
| Active Site | ACT_SITE 81; /evidence=ECO:0000250|UniProtKB:Q6RYA0; ACT_SITE 208; /evidence=ECO:0000250|UniProtKB:Q6RYA0; ACT_SITE 236; /evidence=ECO:0000250|UniProtKB:Q6RYA0 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=(R)-mandelonitrile = benzaldehyde + hydrogen cyanide; Xref=Rhea:RHEA:18313, ChEBI:CHEBI:17169, ChEBI:CHEBI:18407, ChEBI:CHEBI:18450; EC=4.1.2.10; Evidence={ECO:0000269|PubMed:17907254}; |
| DNA Binding | |
| EC Number | 4.1.2.10 |
| Enzyme Function | FUNCTION: Involved in cyanogenesis, the release of HCN from injured tissues (By similarity). Displays R-selective hydroxynitrile lyase activity. Also accepts nitromethane (MeNO2) as a donor in a reaction with aromatic aldehydes to yield (R)-beta-nitro alcohols. {ECO:0000250, ECO:0000269|PubMed:17907254, ECO:0000269|PubMed:18467465, ECO:0000269|PubMed:19433222, ECO:0000269|PubMed:21439333}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (10); Chain (1); Helix (14); Mutagenesis (3); Sequence conflict (3); Turn (1) |
| Keywords | 3D-structure;Lyase;Reference proteome |
| Interact With | O23171 |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (9) |
| Cross Reference PDB | 3DQZ; 6COB; 6COC; 6COD; 6COE; 6COF; 6COG; 6COH; 6COI; |
| Mapped Pubmed ID | 12535340; 15235117; 16173598; 17675405; 18643994; 19576280; 21798944; 22378361; 22544258; 22851196; 23728815; 25052541; 25755120; 28627464; 28798888; 30411458; 30537160; 31379907; 33044692; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,217 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.4 mM for mandelonitrile {ECO:0000269|PubMed:19433222}; |
| Metal Binding | |
| Rhea ID | RHEA:18313 |
| Cross Reference Brenda | 4.1.2.10; |