| IED ID | IndEnz0010001092 |
| Enzyme Type ID | esterase001092 |
| Protein Name |
Esterase dbaE EC 3.1.2.- Derivative of benzaldehyde biosynthesis cluster protein E |
| Gene Name | dbaE ANIA_07899 |
| Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Nidulantes Emericella nidulans (Aspergillus nidulans) Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Enzyme Sequence | MTIRIPSGEEADYTLHLPRILCLHGGGTNARIFRMQCRVLERFLRSTFRFVYAEAPFAAQPGSDVTSVYKDHGPFKAWLRCTAADPDRSAQEVVKKINLSIATAMYDDDMRGATGEWIALLGFSQGAKVAASILYAQQTIQQRLGERAATRPRFRFAVLMAGRGPLVWLLPETSSGPGSIPMGLVDAASPSMLDSEPELPTDSTEHMLRLPTLHVHGLRDPGLSLHRRLLRSYCQSDSVSLVEWEGEHRVPLKTKDVTAVVDQIYALARDTGVLDSWC |
| Enzyme Length | 278 |
| Uniprot Accession Number | Q5AUY1 |
| Absorption | |
| Active Site | ACT_SITE 124; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 220; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 248; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.2.- |
| Enzyme Function | FUNCTION: Esterase; part of the gene cluster that mediates the biosynthesis of the antibiotic 2,4-dihydroxy-3-methyl-6-(2-oxopropyl)benzaldehyde (DHMBA) and its derivatives (PubMed:22510154, PubMed:23001671). The direct non-reducing polyketide synthase dbaI product is 2,4-dihydroxy-3-methyl-6-(2-oxopropyl)benzaldehyde (DHMBA), produced by condensation of one acetyl-CoA starter unit with 4 malonyl-CoA units and one methylation step (PubMed:22510154). The FAD-dependent monooxygenase dbaH is responsible for the synthesis of yellow pigments derived from the oxidation of DHMBA (PubMed:23001671). The roles of dbaB, C, E and F have still to be determined (Probable). {ECO:0000269|PubMed:22510154, ECO:0000269|PubMed:23001671, ECO:0000305|PubMed:23001671}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Secondary metabolite biosynthesis. {ECO:0000305|PubMed:23001671}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Deletion of the conserved eukaryotic csnE deneddylase subunit of the COP9 signalosome leading to defect in protein degradation results in the activation of the silenced dba gene cluster (PubMed:23001671). Expression is positively regulated by the dba cluster specific transcription factor dbaA (PubMed:23001671). Expression is also controlled by the transcription factor flbB (PubMed:25701285). {ECO:0000269|PubMed:23001671, ECO:0000269|PubMed:25701285}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,793 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |