| IED ID | IndEnz0010001093 |
| Enzyme Type ID | esterase001093 |
| Protein Name |
Probable feruloyl esterase C EC 3.1.1.73 Ferulic acid esterase C |
| Gene Name | faeC AO090023000158 |
| Organism | Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus oryzae (Yellow koji mold) Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold) |
| Enzyme Sequence | MIKSIILQAIMVLSTLTSVHGANSSGCGKQPTLVNGVHKINDREYILKVPDNYNANKPHHLIFGLHWRGGNMNSVVNGESVEPWYGLETRAQGSAILVAPNGRNAGWANINGEDVALIDAIIKQVEDDLCIDQSSRFATGFSWGGGMSYALACARAKEFRAVSVLSGGVISGCEGGHDPIAYLGIHGISDPVLPFDGGVTLANKFAANNGCQQTYVGKPGLGSHSSVQTDFKGCSRPVSFIAYDGGHDAAPLGVGNPLAPDATWKFFMAA |
| Enzyme Length | 270 |
| Uniprot Accession Number | Q2UI81 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Feruloyl-polysaccharide + H(2)O = ferulate + polysaccharide.; EC=3.1.1.73; |
| DNA Binding | |
| EC Number | 3.1.1.73 |
| Enzyme Function | FUNCTION: Involved in degradation of plant cell walls. Hydrolyzes the feruloyl-arabinose ester bond in arabinoxylans, and the feruloyl-galactose ester bond in pectin. Active against paranitrophenyl-acetate, methyl ferulate and wheat arabinoxylan (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Frameshift (1); Glycosylation (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Glycoprotein;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,427 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |