| IED ID | IndEnz0010001112 |
| Enzyme Type ID | esterase001112 |
| Protein Name |
Acetyl esterase Axe7A EC 3.1.1.- |
| Gene Name | axe7A PRU_2678 |
| Organism | Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) |
| Taxonomic Lineage | cellular organisms Bacteria FCB group Bacteroidetes/Chlorobi group Bacteroidetes Bacteroidia Bacteroidales Prevotellaceae Prevotella Prevotella ruminicola (Bacteroides ruminicola) Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) |
| Enzyme Sequence | MFNFAPKQTTEMKKLLFTLVFVLGSMATALAENYPYRADYLWLTVPNHADWLYKTGERAKVEVSFCLYGMPQNVEVAYEIGPDMMPATSSGKVTLKNGRAVIDMGTMKKPGFLDMRLSVDGKYQHHVKVGFSPELLKPYTKNPQDFDAFWKANLDEARKTPVSVSCNKVDKYTTDAFDCYLLKIKTDRRHSIYGYLTKPKKAGKYPVVLCPPGAGIKTIKEPMRSTFYAKNGFIRLEMEIHGLNPEMTDEQFKEITTAFDYENGYLTNGLDDRDNYYMKHVYVACVRAIDYLTSLPDWDGKNVFVQGGSQGGALSLVTAGLDPRVTACVANHPALSDMAGYLDNRAGGYPHFNRLKNMFTPEKVNTMAYYDVVNFARRITCPVYITWGYNDNVCPPTTSYIVWNLITAPKESLITPINEHWTTSETNYTQMLWLKKQVK |
| Enzyme Length | 439 |
| Uniprot Accession Number | D5EXI2 |
| Absorption | |
| Active Site | ACT_SITE 309; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 391; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 420; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Involved in degradation of plant cell wall polysaccharides. Has acetyl esterase activity towards a broad range of substrates including xylose-tetraacetate, 4-O-methylumbelliferyl acetate, glucose-pentaacetate, cephalosporin C, and acetylated xylo-oligosaccharides smaller than xylo-heptaose. Displays no detectable activity on polymeric acetylated xylan. {ECO:0000269|PubMed:21742923}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 40 degrees Celsius with glucose-pentaacetate as substrate. Active from 30 to 50 degrees Celsius. At temperatures of 30 degrees Celsius and lower, less than 10% of the maximum activity is left. At 50 degrees Celsius, retains 60% of its maximum activity. {ECO:0000269|PubMed:21742923}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.0 with glucose-pentaacetate as substrate. Active from pH 5.0 to 8.0. {ECO:0000269|PubMed:21742923}; |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. {ECO:0000269|PubMed:21742923}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Hydrolase;Polysaccharide degradation;Reference proteome;Serine esterase;Signal;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..31; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 49,867 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |