| IED ID | IndEnz0010001181 |
| Enzyme Type ID | esterase001181 |
| Protein Name |
Esterase citA EC 3.1.2.- Citrinin synthesis protein A |
| Gene Name | citA mrl1 |
| Organism | Monascus ruber (Mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Monascus Monascus ruber (Mold) |
| Enzyme Sequence | MVQTNLEVVDDTLHLPRILCLHGGGSNAAIFQAQCRRLIAQLRSEFRFVFAQAPFLSDAEPNVMSVYSQWGPFRRWLRWCPDHPEIRPEDAIRAIDDCLEDVKRQDDAKGATGAWVGLLGFSQGAKMCASLLYRQQIRQELRGRSFAGSDYRFGVLLAGRAPLVSLDPDLDLNSSLPDVSQITDAKYHGPSQDVLRIPTVHVHGMRDPHVDLHRQLFEEFCAPESRRLVEWDGDHRVPLKYNDVSLVAYQIRELATQTGAP |
| Enzyme Length | 261 |
| Uniprot Accession Number | A0A161CKG1 |
| Absorption | |
| Active Site | ACT_SITE 122; /note=Charge relay system; /evidence=ECO:0000269|PubMed:29189834; ACT_SITE 207; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 235; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.2.- |
| Enzyme Function | FUNCTION: Non-reducing polyketide synthase; part of the gene cluster that mediates the biosynthesis of the mycotoxin citrinin, a hepato-nephrotoxic compound to humans due to inhibition of respiration complex III (Ref.1, PubMed:29189834). The pathway begins with the synthesis of a keto-aldehyde intermediate by the citrinin PKS (pksCT also named citS) from successive condensations of 4 malonyl-CoA units, presumably with a simple acetyl-CoA starter unit (Ref.1, PubMed:29189834). Release of the keto-aldehyde intermediate is consistent with the presence of the C-terminal reductive release domain (Ref.1). CitA collaborates with citS by catalyzing the hydrolysis of ACP-bound acyl intermediates to free the ACP from stalled intermediates (PubMed:29189834). CitB then catalyzes the oxidation of the C-12 methyl of the ketone intermediate to an alcohol intermediate which is further oxidized by the oxidoreductase citC to produce a bisaldehyde intermediate (Ref.1). The fourth catalytic step is catalyzed by the citD aldehyde dehydrogenase (Ref.1). The final transformation is the reduction of C-3 by citE to provide the chemically stable citrinin nucleus (Ref.1). CitE appears highly selective for its substrate as its presence in any context other than a full complement of citS and citA-D does not result in observable new compounds (Ref.1). {ECO:0000269|PubMed:29189834, ECO:0000269|Ref.1}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Mycotoxin biosynthesis. {ECO:0000269|Ref.1}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Mutagenesis (1) |
| Keywords | Hydrolase |
| Interact With | |
| Induction | INDUCTION: Expression is stimulated under green light conditions (PubMed:27998068). {ECO:0000269|PubMed:27998068}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,501 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |