| IED ID | IndEnz0010001184 |
| Enzyme Type ID | esterase001184 |
| Protein Name |
Probable cutinase 1 EC 3.1.1.74 Cutin hydrolase 1 |
| Gene Name | NFIA_084890 |
| Organism | Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Aspergillus fischeri Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus) |
| Enzyme Sequence | MKFALLSLAAMAVASPVAIDVRQTAIAGDELRTGPCEPITFIFARGSTEPGLLGITTGPGVCNALKLSRPGQVACQGVGPAYIADLASNFLPQGTNQIAIDEAAGLFKLAASKCPNTKIVAGGYSQGAAVMHGAIRNLPSDVQNMIKGVVLFGDTRNKQDGGRIPNFPTDRTKIYCAFGDLVCDGTLIITAAHLSYGDDVPNATSFLLSKV |
| Enzyme Length | 211 |
| Uniprot Accession Number | A1DGN0 |
| Absorption | |
| Active Site | ACT_SITE 125; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:P00590; ACT_SITE 180; /evidence=ECO:0000250|UniProtKB:P00590; ACT_SITE 193; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:P00590 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cutin + H(2)O = cutin monomers.; EC=3.1.1.74; Evidence={ECO:0000255|PROSITE-ProRule:PRU10108, ECO:0000255|PROSITE-ProRule:PRU10109}; |
| DNA Binding | |
| EC Number | 3.1.1.74 |
| Enzyme Function | FUNCTION: Catalyzes the hydrolysis of complex carboxylic polyesters found in the cell wall of plants (By similarity). Degrades cutin, a macromolecule that forms the structure of the plant cuticle (By similarity). {ECO:0000250|UniProtKB:P00590}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Glycosylation (1); Signal peptide (1); Site (2) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Reference proteome;Secreted;Serine esterase;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P11373}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,868 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |