| IED ID | IndEnz0010001233 |
| Enzyme Type ID | esterase001233 |
| Protein Name |
Probable strigolactone esterase DAD2 EC 3.1.-.- Protein DECREASED APICAL DOMINANCE 2 |
| Gene Name | DAD2 |
| Organism | Petunia hybrida (Petunia) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Petunioideae Petunia Petunia hybrida (Petunia) |
| Enzyme Sequence | MGQTLLDALNVRVVGSGERVLVLAHGFGTDQSAWNRILPFFLRDYRVVLYDLVCAGSVNPDFFDFRRYTTLDPYVDDLLHILDALGIDCCAYVGHSVSAMIGILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARDHSVPASVATYLKNHLGGKNTVHWLNIEGHLPHLSAPTLLAQELRRALSHR |
| Enzyme Length | 267 |
| Uniprot Accession Number | J9U5U9 |
| Absorption | |
| Active Site | ACT_SITE 96; /note=Nucleophile; /evidence=ECO:0000269|PubMed:22959345; ACT_SITE 217; /evidence=ECO:0000250|UniProtKB:Q10QA5; ACT_SITE 246; /evidence=ECO:0000269|PubMed:22959345 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Involved in strigolactone signaling pathway. May function downstream of strigolactone synthesis, as a component of hormone signaling or as an enzyme that participates in the conversion of strigolactones to the bioactive form. Can hydrolyze the synthetic strigolactone analog GR24 in vitro. Strigolactones are hormones that inhibit tillering and shoot branching through the MAX-dependent pathway, contribute to the regulation of shoot architectural response to phosphate-limiting conditions and function as rhizosphere signal that stimulates hyphal branching of arbuscular mycorrhizal fungi and trigger seed germination of root parasitic weeds. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (9); Chain (1); Helix (14); Mutagenesis (2); Turn (3) |
| Keywords | 3D-structure;Hydrolase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (7) |
| Cross Reference PDB | 4DNP; 4DNQ; 6AP6; 6AP7; 6O5J; 6UH8; 6UH9; |
| Mapped Pubmed ID | 29523686; 31186286; 32071083; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,712 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |