| IED ID | IndEnz0010001278 |
| Enzyme Type ID | esterase001278 |
| Protein Name |
Probable Fe-S-dependent transcriptional repressor |
| Gene Name | feoC ORF2 |
| Organism | Serratia marcescens |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Serratia Serratia marcescens |
| Enzyme Sequence | MAGLLQVRDALALRATSGAQLSQSLATPLPLVQAMLDRLTAMGKVERIEQDDGACLSGGCKSCPQPRGAARCSTG |
| Enzyme Length | 75 |
| Uniprot Accession Number | Q8GHK8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May function as a transcriptional regulator that controls feoABC expression. {ECO:0000255|HAMAP-Rule:MF_01586}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Metal binding (4) |
| Keywords | DNA-binding;Iron;Iron-sulfur;Metal-binding;Repressor;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,714 |
| Kinetics | |
| Metal Binding | METAL 55; /note=Iron-sulfur; /evidence=ECO:0000255|HAMAP-Rule:MF_01586; METAL 60; /note=Iron-sulfur; /evidence=ECO:0000255|HAMAP-Rule:MF_01586; METAL 63; /note=Iron-sulfur; /evidence=ECO:0000255|HAMAP-Rule:MF_01586; METAL 72; /note=Iron-sulfur; /evidence=ECO:0000255|HAMAP-Rule:MF_01586 |
| Rhea ID | |
| Cross Reference Brenda |