| IED ID | IndEnz0010001299 |
| Enzyme Type ID | esterase001299 |
| Protein Name |
2-hydroxy-6-oxo-6- 2'-aminophenyl hexa-2,4-dienoic acid hydrolase HOPDA EC 3.7.1.13 |
| Gene Name | carC |
| Organism | Pseudomonas resinovorans |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa group Pseudomonas resinovorans |
| Enzyme Sequence | MLNKAEQISEKSESAYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDLRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVPVPTLVVHGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSRRADITRAAA |
| Enzyme Length | 290 |
| Uniprot Accession Number | Q9AQM4 |
| Absorption | |
| Active Site | ACT_SITE 114; /evidence=ECO:0000305; ACT_SITE 233; /evidence=ECO:0000250; ACT_SITE 261; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=(2E,4E)-6-(2-aminophenyl)-2-hydroxy-6-oxohexa-2,4-dienoate + H2O = (2E)-2-hydroxypenta-2,4-dienoate + anthranilate + H(+); Xref=Rhea:RHEA:27870, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16567, ChEBI:CHEBI:60885, ChEBI:CHEBI:60886; EC=3.7.1.13; Evidence={ECO:0000269|PubMed:12619671, ECO:0000269|PubMed:12651123}; |
| DNA Binding | |
| EC Number | 3.7.1.13 |
| Enzyme Function | FUNCTION: Involved in the degradation of carbazole, a toxic N-heterocyclic aromatic compound containing dibenzopyrrole system. Catalyzes the hydrolytic cleavage of a carbon-carbon bond of 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid (HOPDA) to yield anthranilate. CarC is specific for 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid (6-phenyl-HODA), and has little activity toward 2-hydroxy-6-oxohepta-2,4-dienoic acid and 2-hydroxymuconic semialdehyde. The effect of the presence of an amino group or hydroxyl group at the 2'-position of phenyl moiety of 6-phenyl-HODA on the enzyme activity is found to be small. {ECO:0000269|PubMed:12619671, ECO:0000269|PubMed:12651123, ECO:0000269|PubMed:9244273}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 58 degrees Celsius. {ECO:0000269|PubMed:12619671, ECO:0000269|PubMed:12651123}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is between 7.0 and 7.5. {ECO:0000269|PubMed:12619671, ECO:0000269|PubMed:12651123}; |
| Pathway | PATHWAY: Xenobiotic degradation; carbazole degradation. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Mutagenesis (1) |
| Keywords | Aromatic hydrocarbons catabolism;Hydrolase;Plasmid |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid pCAR1 |
| Mass | 32,252 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=2.51 uM for 6-phenyl-HODA (at 50 mM sodium phosphate, pH 7.5, 25 degrees Celsius) {ECO:0000269|PubMed:12619671, ECO:0000269|PubMed:12651123}; KM=4.6 uM for HOPDA (at pH 7.5 and 25 degrees Celsius) {ECO:0000269|PubMed:12619671, ECO:0000269|PubMed:12651123}; Vmax=3.3 mmol/min/mg enzyme with HOPDA as substrate (at pH 7.5 and 25 degrees Celsius) {ECO:0000269|PubMed:12619671, ECO:0000269|PubMed:12651123}; Note=kcat is 2.14 sec(-1) for 6-phenyl-HODA (at 50 mM sodium phosphate, pH 7.5, 25 degrees Celsius).; |
| Metal Binding | |
| Rhea ID | RHEA:27870 |
| Cross Reference Brenda | 3.7.1.13; |