| IED ID | IndEnz0010001353 |
| Enzyme Type ID | esterase001353 |
| Protein Name |
Methylesterase 9 AtMES9 EC 3.1.1.- |
| Gene Name | MES9 At4g37150 AP22.78 C7A10.210 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MKHYVLVHGGCHGAWCWYKVKPMLEHSGHRVTVFDLTAHGVNMSRVEDIQTLEDFAKPLLEVLESFGSDDKVVLVAHSLGGIPAALAADMFPSKISVAVFVTSFMPDTTNPPSYVFEKFLGSITEEERMDFELGSYGTDDHPLKTAFLGPNYLKNMYLLSPIEDYELAKMLMRVTPAITSNLTGTKSLTAQGYGSISRVYIVCGEDKGIRVDFQRWMIENSPVKEVMEIKDADHMPMFSKPHELCDRLLKIADKYP |
| Enzyme Length | 256 |
| Uniprot Accession Number | O23171 |
| Absorption | |
| Active Site | ACT_SITE 78; /note=Acyl-ester intermediate; /evidence=ECO:0000250|UniProtKB:Q6RYA0; ACT_SITE 206; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q6RYA0; ACT_SITE 234; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q6RYA0 |
| Activity Regulation | ACTIVITY REGULATION: Esterase activity is down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:18643994}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + methyl (indol-3-yl)acetate = (indol-3-yl)acetate + H(+) + methanol; Xref=Rhea:RHEA:32919, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:30854, ChEBI:CHEBI:72782; Evidence={ECO:0000269|PubMed:18467465};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:32920; Evidence={ECO:0000269|PubMed:18467465}; CATALYTIC ACTIVITY: Reaction=H2O + methyl (-)-jasmonate = H(+) + jasmonate + methanol; Xref=Rhea:RHEA:55372, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15929, ChEBI:CHEBI:17790, ChEBI:CHEBI:58431; Evidence={ECO:0000269|PubMed:18467465};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:55373; Evidence={ECO:0000269|PubMed:18467465}; CATALYTIC ACTIVITY: Reaction=H2O + methyl salicylate = H(+) + methanol + salicylate; Xref=Rhea:RHEA:33611, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:30762, ChEBI:CHEBI:31832; Evidence={ECO:0000269|PubMed:18467465};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:33612; Evidence={ECO:0000269|PubMed:18467465}; |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Methylesterase shown to have carboxylesterase activity, methyl indole-3-acetic acid (MeIAA) esterase activity, methyl salicylate (MeSA) esterase activity and methyl jasmonate (MeJA) esterase activity in vitro. Required to convert methyl salicylate (MeSA) to salicylic acid (SA) as part of the signal transduction pathways that activate systemic acquired resistance in systemic tissue. MeSA is believed to be an inactive form that needs to be demethylated to exert a biological effect. {ECO:0000269|PubMed:18467465, ECO:0000269|PubMed:18643994}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Plant hormone biosynthesis. {ECO:0000269|PubMed:18467465}.; PATHWAY: Lipid metabolism; oxylipin biosynthesis. {ECO:0000269|PubMed:18467465}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase;Immunity;Innate immunity;Plant defense;Reference proteome |
| Interact With | Q9LFT6 |
| Induction | INDUCTION: By pathogen infection. {ECO:0000269|PubMed:18643994}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16262716; 17478635; 18650403; 20687805; 21798944; 23567274; 23858430; 23959884; 31087367; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,744 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=147.1 uM for methyl salicylate (MeSA) {ECO:0000269|PubMed:18643994}; Vmax=25.88 nmol/min/ug enzyme with methyl salicylate (MeSA) as substrate {ECO:0000269|PubMed:18643994}; |
| Metal Binding | |
| Rhea ID | RHEA:32919; RHEA:32920; RHEA:55372; RHEA:55373; RHEA:33611; RHEA:33612 |
| Cross Reference Brenda |