| IED ID | IndEnz0010001358 |
| Enzyme Type ID | esterase001358 |
| Protein Name |
Cyclin-dependent-like kinase 5 EC 2.7.11.1 Cell division protein kinase 5 |
| Gene Name | cdk-5 T27E9.3 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MLNYDKMEKIGEGTYGTVFKARNKNSGEIVALKRVRLDDDDEGVPSSALREICILRELKHRNVVRLYDVVHSENKLTLVFEYCDQDLKKFFDSLNGYMDAQTARSLMLQLLRGLSFCHAHHVLHRDLKPQNLLINTNGTLKLADFGLARAFGVPVRCFSAEVVTLWYRPPDVLFGAKLYNTSIDMWSAGCIFAEISNAGRPLFPGADVDDQLKRIFKQLGSPSEDNWPSITQLPDYKPYPIYHPTLTWSQIVPNLNSRGRDLLQKLLVCNPAGRIDADAALRHAYFADTSDV |
| Enzyme Length | 292 |
| Uniprot Accession Number | G5ECH7 |
| Absorption | |
| Active Site | ACT_SITE 126; /note=Proton acceptor; /evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Activity Regulation | |
| Binding Site | BINDING 33; /note=ATP; /evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:20510931}; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:20510931}; |
| DNA Binding | |
| EC Number | 2.7.11.1 |
| Enzyme Function | FUNCTION: Proline-directed serine/threonine-protein kinase which, in several motor neurons, promotes the polarized trafficking of synaptic vesicles and dense-core vesicles (DCV). In the ventral nerve cord, phosphorylates lin-10 and thereby prevents lin-10-mediated anterograde trafficking of the glutamate receptor glr-1 (PubMed:17671168, PubMed:21609829). Involved in the inhibition of glr-1 trafficking in hypoxic conditions (PubMed:22252129). In DA motor neurons but not in DB motor neurons, regulates axonal transport of synaptic vesicle precursors by inhibiting dynein-mediated retrograde transport (PubMed:20510931). Regulates the trafficking of dense-core vesicles in DA and DB motor neurons by promoting anterograde trafficking to the axon and preventing dynein-dependent trafficking to the dendrite (PubMed:22699897). May regulate these processes in association with cdka-1/p35 (PubMed:17671168, PubMed:20510931). Activity may be regulated by cyy-1 (PubMed:20510931). Involved in synapse formation during DD motor neuron remodeling by regulating transport of disassembled synaptic material to the new synaptic sites probably by activating the motor protein unc-104/kinesin-3 (PubMed:21609829). Regulates microtubule polarity in the dendrite of DB motor neurons (PubMed:22699897). May also play a role in GABAergic synaptic vesicle localization in the ventral nerve cord (PubMed:16996038). {ECO:0000269|PubMed:16996038, ECO:0000269|PubMed:17671168, ECO:0000269|PubMed:20510931, ECO:0000269|PubMed:21609829, ECO:0000269|PubMed:22252129, ECO:0000269|PubMed:22699897}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 10..18; /note=ATP; /evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Features | Active site (1); Binding site (1); Chain (1); Domain (1); Metal binding (2); Mutagenesis (2); Nucleotide binding (1) |
| Keywords | ATP-binding;Cell cycle;Cell division;Cell projection;Cytoplasm;Kinase;Magnesium;Metal-binding;Neurogenesis;Nucleotide-binding;Reference proteome;Serine/threonine-protein kinase;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:20510931}. Cell projection, dendrite {ECO:0000269|PubMed:20510931}. Note=Localizes predominantly to presynaptic sites and in dendrites as faint puncta. {ECO:0000269|PubMed:20510931}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15687288; 19123269; 21085631; 21177967; 22286215; 22560298; 23800452; 25487147; 30254025; 8395047; |
| Motif | |
| Gene Encoded By | |
| Mass | 33,063 |
| Kinetics | |
| Metal Binding | METAL 131; /note=Magnesium; /evidence=ECO:0000250|UniProtKB:P24941; METAL 144; /note=Magnesium; /evidence=ECO:0000250|UniProtKB:P24941 |
| Rhea ID | RHEA:17989; RHEA:46608 |
| Cross Reference Brenda |