| IED ID | IndEnz0010001364 |
| Enzyme Type ID | esterase001364 |
| Protein Name |
Esterase mpl1 EC 3.1.2.- Citrinin synthesis protein B |
| Gene Name | mpl1 ctnB |
| Organism | Monascus purpureus (Red mold) (Monascus anka) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Monascus Monascus purpureus (Red mold) (Monascus anka) |
| Enzyme Sequence | MKGQTGLRSLALLYISPLYILERLPLKLSAPDTLVVRGSFIVPTEPLYPSITMVQTNLEVVDDTLHLPRILCLHGGGSNAAIFQAQCRRLIAQLRSEFRFVFAQAPFLSDAEPNVMSVYSQWGPFRRWLRWCPDHPEIRPEDAIRAIDDCLEDVKRQDDAKGATGAWVGLLGFSQGAKMCASLLYRQQIRQELRGRSFAGSDYRFGVLLAGRAPLVSLDPDLDLNSSLPDVSQITDAKYHGPSQDVLRIPTVHVHGMRDPHVDLHRQLFEEFCAPESRRLVEWDGDHRVPLKYNDVSLVAYQIRELATQTGAP |
| Enzyme Length | 313 |
| Uniprot Accession Number | Q1ERH9 |
| Absorption | |
| Active Site | ACT_SITE 174; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 259; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 287; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.2.- |
| Enzyme Function | FUNCTION: Esterase; part of the gene cluster that mediates the biosynthesis of the mycotoxin citrinin, a hepato-nephrotoxic compound to humans due to inhibition of respiration complex III (PubMed:17586673, PubMed:19012408, PubMed:28238725, PubMed:19111642, PubMed:27913218). The pathway begins with the synthesis of a keto-aldehyde intermediate by the citrinin PKS (pksCT) from successive condensations of 4 malonyl-CoA units, presumably with a simple acetyl-CoA starter unit (PubMed:28238725). Release of the keto-aldehyde intermediate is consistent with the presence of the C-terminal reductive release domain (PubMed:28238725). Mp11 collaborates with pksCT by catalyzing the hydrolysis of ACP-bound acyl intermediates to free the ACP from stalled intermediates (By similarity). Mpl2 then catalyzes the oxidation of the C-12 methyl of the ketone intermediate to an alcohol intermediate which is further oxidized by the oxidoreductase mpl7 to produce a bisaldehyde intermediate (PubMed:27913218). The fourth catalytic step is catalyzed by the mpl4 aldehyde dehydrogenase (PubMed:27913218). The final transformation is the reduction of C-3 by mpl6 to provide the chemically stable citrinin nucleus (PubMed:27913218). {ECO:0000250|UniProtKB:A0A161CKG1, ECO:0000269|PubMed:17586673, ECO:0000269|PubMed:19012408, ECO:0000269|PubMed:19111642, ECO:0000269|PubMed:27913218, ECO:0000269|PubMed:28238725}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Mycotoxin biosynthesis. {ECO:0000269|PubMed:27913218}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,226 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |