| IED ID | IndEnz0010001459 |
| Enzyme Type ID | esterase001459 |
| Protein Name |
S-formylglutathione hydrolase FrmB FGH EC 3.1.2.12 |
| Gene Name | frmB SSON_0334 |
| Organism | Shigella sonnei (strain Ss046) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Shigella Shigella sonnei Shigella sonnei (strain Ss046) |
| Enzyme Sequence | MELIEKHASFGGWQNVYRHYSQSLKCEMNVGVYLPPKAANEKLPVLYWLSGLTCNEQNFITKSGMQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGAGFYLNATQAPWNEHYKMYDYIRNELPDLVMQHFPATTRKSISGHSMGGLGALVLALRNPDEYVSVSAFSPIVSPSQVPWGQQAFAAYLGENKDAWLDYDPVSLISQGQRVAEIMVDQGLSDDFYAEQLRTPNLEKICQEMNIKTLIRYHEGYDHSYYFVSSFIGEHIAYHANKLNMR |
| Enzyme Length | 277 |
| Uniprot Accession Number | Q3Z551 |
| Absorption | |
| Active Site | ACT_SITE 145; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 221; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 254; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + S-formylglutathione = formate + glutathione + H(+); Xref=Rhea:RHEA:14961, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15740, ChEBI:CHEBI:57688, ChEBI:CHEBI:57925; EC=3.1.2.12; |
| DNA Binding | |
| EC Number | 3.1.2.12 |
| Enzyme Function | FUNCTION: Serine hydrolase involved in the detoxification of formaldehyde. Hydrolyzes S-formylglutathione to glutathione and formate (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,399 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:14961 |
| Cross Reference Brenda |