| IED ID | IndEnz0010001509 |
| Enzyme Type ID | esterase001509 |
| Protein Name |
Strigolactone esterase RMS3 EC 3.1.-.- Protein DWARF 14 homolog PsD14 Protein RAMOSUS 3 |
| Gene Name | RMS3 |
| Organism | Pisum sativum (Garden pea) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Pisum Pisum sativum (Garden pea) |
| Enzyme Sequence | MGTPILDAFNVRVEGSGDKYLVFAHGFGTDQSAWQRVLPYFTRSYKVILYDLVCAGSVNPDHFDFRRYTTLDAYVDDLLNILDSLHVTRCAYVGHSISAMTGMLASIRRPELFSKLILIGASPRFLNDGENYHGGFEQGEIEHVFSAMEANYEAWVNGFAPLAVGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLRGILGLVNVPCCIMQTARDMSVPASVATYMKEHIGGKSTVQWLDTEGHLPHLSAPSYLAHQLEIALSQ |
| Enzyme Length | 267 |
| Uniprot Accession Number | A0A109QYD3 |
| Absorption | |
| Active Site | ACT_SITE 96; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q10QA5; ACT_SITE 218; /evidence=ECO:0000250|UniProtKB:Q10QA5; ACT_SITE 247; /evidence=ECO:0000250|UniProtKB:Q10QA5 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Involved in strigolactone signaling pathway. Functions downstream of strigolactone synthesis, as a component of hormone signaling and as an enzyme that participates in the conversion of strigolactones to the bioactive form. Binds and hydrolyzes the synthetic strigolactone analog GR24 and its enantiomers in vitro. Forms a stable covalent complex with the D-ring of strigolactone, which is essential for hormone bioactivity. The D-ring is attached to His-247 of the catalytic triad. The hydrolysis of strigolactone into a covalently linked intermediate molecule is required to trigger strigolactone signaling. This mechanism defines RMS3 as a non-canonical hormone receptor with dual functions to generate and sense the active form of strigolactone (PubMed:27479744). Strigolactones are hormones that inhibit tillering and shoot branching through the MAX-dependent pathway, contribute to the regulation of shoot architectural response to phosphate-limiting conditions and function as rhizosphere signal that stimulates hyphal branching of arbuscular mycorrhizal fungi and trigger seed germination of root parasitic weeds (Probable). {ECO:0000269|PubMed:27479744, ECO:0000305|PubMed:27479744}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Mutagenesis (3) |
| Keywords | Cytoplasm;Hydrolase;Nucleus |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9SQR3}. Nucleus {ECO:0000250|UniProtKB:Q9SQR3}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,647 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |