| IED ID | IndEnz0010001528 |
| Enzyme Type ID | esterase001528 |
| Protein Name |
Probable esterase KAI2 Protein DWARF-14-like Protein D14-like Protein HYPOSENSITIVE TO LIGHT Protein KARRIKIN INSENSITIVE 2 |
| Gene Name | KAI2 D14L HTL At4g37470 F6G17.120 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDIAM |
| Enzyme Length | 270 |
| Uniprot Accession Number | Q9SZU7 |
| Absorption | |
| Active Site | ACT_SITE 95; /note="Nucleophile"; /evidence="ECO:0000305|PubMed:23349965, ECO:0000305|PubMed:23381136"; ACT_SITE 217; /evidence="ECO:0000305|PubMed:23349965, ECO:0000305|PubMed:23381136"; ACT_SITE 246; /evidence="ECO:0000305|PubMed:23349965, ECO:0000305|PubMed:23381136" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in seed germination and seedling development. Essential for plant responses to karrikins, a class of butenolide compounds, structurally similar to strigolactones, released from burning vegetation that stimulate seed germination and enhance seedling photomorphogenesis. KAI2 is not required for strigolactone-mediated responses, but MAX2 is necessary for responses to karrikins and strigolactones (PubMed:20864454, PubMed:22357928, PubMed:23142794, PubMed:23301669). Lacks detectable hydrolase activity against karrikin (PubMed:23613584). Karrikin binding induces a conformational change (PubMed:23613584). {ECO:0000269|PubMed:20864454, ECO:0000269|PubMed:22357928, ECO:0000269|PubMed:23142794, ECO:0000269|PubMed:23301669, ECO:0000269|PubMed:23613584}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (7); Chain (1); Helix (16); Mutagenesis (4); Turn (2) |
| Keywords | 3D-structure;Cytoplasm;Hydrolase;Nucleus;Reference proteome |
| Interact With | Q9LNT9; Q9M995; A0A178W7C6; O22842; Q8GY60; O82754; A0A178UN96; Q94AW8; A0A178V0W2; Q8GXL7; Q9SZN7; O80480; Q38997; F4JH01; Q38950; Q9STT1; Q39255; Q9FHW7; Q93Z00; O64647; Q84MB2; Q9SP35; A0ME53 |
| Induction | INDUCTION: By red light. {ECO:0000269|PubMed:23142794}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:20864454}. Cytoplasm, cytosol {ECO:0000269|PubMed:20864454}. Note=Weak expression in the cytosol. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (9) |
| Cross Reference PDB | 3W06; 4HRX; 4HRY; 4HTA; 4IH1; 4JYM; 4JYP; 5Z9G; 5Z9H; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,791 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |