| IED ID | IndEnz0010001546 |
| Enzyme Type ID | esterase001546 |
| Protein Name |
Pectinesterase inhibitor 10 Pectin methylesterase inhibitor 10 AtPMEI10 |
| Gene Name | PMEI10 At1g62760 F23N19.12 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MNILSQTQILHLSIAILLFITTSSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSSSSSTYSNQTNLDYIKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKFVKNISHGGGLTRLEVVAVADCVEEIGDSVTSLQDSIRELDSINYKDSAKFEMVMSDVETWVSAALTNDDTCMDGFSLVKTAVKDLVRRHVVEVARLTSNALALINMYASTQENFS |
| Enzyme Length | 312 |
| Uniprot Accession Number | Q9SI74 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Pectin methylesterase (PME) inhibitor involved in the maintenance of cell wall integrity in response to necrotrophic pathogens. Modulates PME activity and pectin methylesterification during infection by Botrytis cinerea and contributes to resistance against the pathogen. {ECO:0000269|PubMed:28082716}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Disulfide bond (2); Glycosylation (4); Region (1); Signal peptide (1) |
| Keywords | Apoplast;Disulfide bond;Glycoprotein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Induced in leaves during infection by Botrytis cinerea. {ECO:0000269|PubMed:28082716}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, apoplast {ECO:0000250|UniProtKB:Q9STY5}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14576160; 15082927; 15860015; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,354 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |