IED ID | IndEnz0010001571 |
Enzyme Type ID | esterase001571 |
Protein Name |
Acyl-coenzyme A thioesterase 10, mitochondrial Acyl-CoA thioesterase 10 EC 3.1.2.- Mitochondrial 48 kDa acyl-CoA thioester hydrolase 2 Mt-ACT48.2 |
Gene Name | Acot10 |
Organism | Mus musculus (Mouse) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
Enzyme Sequence | MKRAAMRLWTLNKGLLTHGRGLSQGSQYKISEPLHIHQVQVKLREIVGISTVWRDHVQAMEERKLLHSFLPKSQKVLPPRKIRDSYIEVLLPLGTDPELRDKYVTVQNTVRFGRILEDLDSLGVLVCYMHNHNHSTNMSLLSIVTVLVDKIDMCKHSLSPEQDIKFTGHVSWVGNTTMEVKMKMFQLHDDETYWPVLDATFVMVAQDSENKRPAFVNPLIPENKEEEELFTQGELNKSRRIAFSTSSLLKVAPSSEERNIIHELFLSTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQGNYIQVRVHSEVFSLDSREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHFKSMSTPVTLKKDYPVEP |
Enzyme Length | 439 |
Uniprot Accession Number | Q32MW3 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.1.2.- |
Enzyme Function | FUNCTION: Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels. Active on long chain acyl-CoAs. {ECO:0000305}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Domain (2); Sequence conflict (6); Transit peptide (1) |
Keywords | Hydrolase;Mitochondrion;Reference proteome;Repeat;Serine esterase;Transit peptide |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:10383425, ECO:0000305}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 14651853; 16103133; 18614015; |
Motif | |
Gene Encoded By | |
Mass | 50,552 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |