| IED ID | IndEnz0010001655 |
| Enzyme Type ID | esterase001655 |
| Protein Name |
Esterase tropF EC 3.1.2.- Tropolone synthesis protein F |
| Gene Name | tropF tsR3 TSTA_117780 |
| Organism | Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Trichocomaceae Talaromyces Talaromyces sect. Talaromyces Talaromyces stipitatus Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum) |
| Enzyme Sequence | MLHGMSPECALSKLLSSLEFHTLYRYTMTQKHNFPSNNKDTLHLPRILCLHGGGTNARIFRAQCRALEKALRTSFRLCYAEALFPSQPGPDVTAVYRDFGPFRAWIDSPDANPVTMTEALQISICKAIMEDDQRGATGPVVGLLGFSQGAKVCASLILEQQLLGRTFGDHSHLPFRLPQWRFAVLLAGRGPLVTLSHLSVGADIMQKMAHLCENDDSSGLDSQENLGNVILTRELIQVPTIHVHGRKDPALDLHRKLYYDDFDPRYSKVMEWDGAHRVPLKSKDVATLVKEINVLWASVSHSNVQG |
| Enzyme Length | 306 |
| Uniprot Accession Number | B8M9K3 |
| Absorption | |
| Active Site | ACT_SITE 147; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 248; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777; ACT_SITE 276; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P38777 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.2.- |
| Enzyme Function | FUNCTION: Esterase; part of the gene cluster that mediates the biosynthesis of the tropolone class of fungal maleic anhydrides (PubMed:22508998, PubMed:24863423). The pathway begins with the synthesis of 3-methylorcinaldehyde by the non-reducing polyketide synthase (PKS) tropA (PubMed:22508998). 3-methylorcinaldehyde is the substrate for the FAD-dependent monooxygenase tropB to yield a dearomatized hydroxycyclohexadione (PubMed:22508998, PubMed:24863423). The 2-oxoglutarate-dependent dioxygenase tropC then performs the oxidative ring expansion to provide the first tropolone metabolite stipitaldehyde (PubMed:22508998, PubMed:24863423). Trop D converts stipitaldehyde into stipitacetal which is in turn converted to stipitalide by the short-chain dehydrogenase/reductase tropE (PubMed:24863423). The next steps involve tropF, tropG, tropH, tropI and tropJ to form successive tropolone maleic anhydrides including stipitaldehydic, stipitatonic and stipitatic acids (PubMed:24863423). {ECO:0000269|PubMed:22508998, ECO:0000269|PubMed:24863423}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Secondary metabolite biosynthesis. {ECO:0000269|PubMed:24863423}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,110 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |