Detail Information for IndEnz0010001699
IED ID IndEnz0010001699
Enzyme Type ID esterase001699
Protein Name MPT51/MPB51 antigen
Gene Name mpt51 fbpC1 fbpD mpb51 Rv3803c MTV026.08c
Organism Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Taxonomic Lineage cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Enzyme Sequence MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Enzyme Length 299
Uniprot Accession Number P9WQN7
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars. {ECO:0000269|PubMed:14672660}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Beta strand (9); Chain (1); Helix (13); Sequence conflict (1); Signal peptide (1); Turn (3)
Keywords 3D-structure;Acyltransferase;Reference proteome;Secreted;Signal;Transferase
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..26; /evidence=ECO:0000255
Structure 3D X-ray crystallography (1)
Cross Reference PDB 1R88;
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 31,089
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda