| IED ID | IndEnz0010001751 |
| Enzyme Type ID | esterase001751 |
| Protein Name |
Rubredoxin Rdxs |
| Gene Name | rubA ACIAD1066 |
| Organism | Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Moraxellales Moraxellaceae Acinetobacter Acinetobacter baylyi Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
| Enzyme Sequence | MKKYQCIVCGWIYDEAEGWPQDGIAPGTKWEDIPDDWTCPDCGVSKVDFEMIEV |
| Enzyme Length | 54 |
| Uniprot Accession Number | P42453 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in the hydrocarbon hydroxylating system, which transfers electrons from NADH to rubredoxin reductase and then through rubredoxin to alkane 1 monooxygenase. {ECO:0000269|PubMed:10400587}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Hydrocarbon metabolism; alkane degradation. |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Metal binding (4) |
| Keywords | Cytoplasm;Electron transport;Iron;Metal-binding;Reference proteome;Transport |
| Interact With | |
| Induction | INDUCTION: Constitutively expressed. {ECO:0000269|PubMed:10400587}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,199 |
| Kinetics | |
| Metal Binding | METAL 6; /note=Iron; /evidence=ECO:0000255|PROSITE-ProRule:PRU00241; METAL 9; /note=Iron; /evidence=ECO:0000255|PROSITE-ProRule:PRU00241; METAL 39; /note=Iron; /evidence=ECO:0000255|PROSITE-ProRule:PRU00241; METAL 42; /note=Iron; /evidence=ECO:0000255|PROSITE-ProRule:PRU00241 |
| Rhea ID | |
| Cross Reference Brenda |