Detail Information for IndEnz0010001784
IED ID IndEnz0010001784
Enzyme Type ID esterase001784
Protein Name Protein trichome birefringence-like 39
Gene Name TBL39 At2g42570 F14N22.16
Organism Arabidopsis thaliana (Mouse-ear cress)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress)
Enzyme Sequence MGFTSRGNPSFLFFFFFFLCLSTVSAYINSTSSNNDEVRRELASGRCNWFRGNWVYDVKYPLYDPYKCPFIDPQFNCKKYGRPDNAYLKYRWQPSSCSLPRFNGLYFLRRMRGKKIMFVGDSLSTNMWQSLACLIHSWVPNTRYTLIRQKGLASLTFEEYGVTLLLYRTQFLVDLNVEKVGRVLKLDSIKQGNMWRGMDVLIFNSWHWWTHTEHIQPWDYMEDGNRLYKDMNRLVAFYKGMTTWARWVNAYVDPSKTKVFFNGVSPTHYEGKDWGEPMNSCRSQTQPFYGRKYPGGTPMAWVILNKVMRRLKKPVHWLDITGLSQLRKDAHPSAFSGNHPGNDCSHWCLPGLPDTWNLLFYSTLFSS
Enzyme Length 367
Uniprot Accession Number Q9SIN2
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: May act as a bridging protein that binds pectin and other cell wall polysaccharides. Probably involved in maintaining esterification of pectins (By similarity). May be involved in the specific O-acetylation of cell wall polymers (By similarity). {ECO:0000250|UniProtKB:Q9FG35, ECO:0000250|UniProtKB:Q9LY46}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Motif (2); Transmembrane (1)
Keywords Membrane;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 12753585; 14760709; 16776300; 16911220; 32354790;
Motif MOTIF 120..122; /note=GDS motif; MOTIF 343..357; /note=DCXHWCLPGXXDXWN motif
Gene Encoded By
Mass 43,166
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda