| IED ID | IndEnz0010001791 |
| Enzyme Type ID | esterase001791 |
| Protein Name |
Probable 9-O-acetyl-N-acetylneuraminic acid deacetylase Neu5,9Ac2 deacetylase EC 3.1.1.- Probable 9-O-acetyl-N-acetylneuraminate esterase Probable sialyl esterase NanS |
| Gene Name | nanS yjhS b4309 JW4272 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MNAIISPDYYYVLTVAGQSNAMAYGEGLPLPDREDAPHPRIKQLARFAHTHPGGPPCHFNDIIPLTHCPHDVQDMQGYHHPLATNHQTQYGTVGQALHIARKLLPFIPDNAGILIVPCCRGGSAFTAGSEGTYSERHGASHDACRWGTDTPLYQDLVSRTRAALAKNPQNKFLGACWMQGEFDLMTSDYASHPQHFNHMVEAFRRDLKQYHSQLNNITDAPWFCGDTTWYWKENFPHSYEAIYGNYQNNVLANIIFVDFQQQGERGLTNAPDEDPDDLSTGYYGSAYRSPENWTTALRSSHFSTAARRGIISDRFVEAILQFWRER |
| Enzyme Length | 326 |
| Uniprot Accession Number | P39370 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Probably catalyzes the hydrolysis of the 9-O-acetyl group of 9-O-acetyl-N-acetylneuraminate (Neu5,9Ac2). Is required for growth of E.coli on Neu5,9Ac2, an alternative sialic acid commonly found in mammalian host mucosal sites, in particular in the human intestine. {ECO:0000269|PubMed:19749043}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Hydrolase;Periplasm;Reference proteome;Signal |
| Interact With | |
| Induction | INDUCTION: Induced by N-acetylneuraminate and modulated by N-acetylglucosamine, via the NanR and NagC regulators. {ECO:0000269|PubMed:23935044, ECO:0000305|PubMed:15743943}. |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000305|PubMed:19749043}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 36,878 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.1.1.53; |