Detail Information for IndEnz0010001838
IED ID IndEnz0010001838
Enzyme Type ID esterase001838
Protein Name Protein trichome birefringence-like 41
Gene Name TBL41 At3g14850 T21E2.11
Organism Arabidopsis thaliana (Mouse-ear cress)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress)
Enzyme Sequence MGSKDNAISNDSALVLSLLLLLLLPLLHEAAEGCDMFTGRWVKDDSYPLYNSSTCPFIRHEFSCQRNGRPDLDYSTFRWQPLSCKLARFNGLQFLKKNKGKKIMFVGDSLSLNQWQSLACMLHSSVPNSTYTLTTQGSISTYTFKEYGLELKLDRNVYLVDIVREKIGRVLKLDSINDGKNWVEMDTLIFNTWHWWSRRGPAQPWDLIQIGTNVTKDMDRVAAFEIALGTWGKWVDTVLNTKKTRVFFQGISPSHYKGVLWGEPAAKSCVGQKEPLLGTKYPGGLPAEVGVLKRALGKISKPVTLLDITMLSLLRKDAHPSVYGLGGRNSSGDCSHWCLSGVPDTWNEILYNYMVE
Enzyme Length 356
Uniprot Accession Number F4IWA8
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: May act as a bridging protein that binds pectin and other cell wall polysaccharides. Probably involved in maintaining esterification of pectins (By similarity). May be involved in the specific O-acetylation of cell wall polymers (By similarity). {ECO:0000250|UniProtKB:Q9FG35, ECO:0000250|UniProtKB:Q9LY46}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Alternative sequence (1); Chain (1); Erroneous gene model prediction (1); Motif (2); Sequence conflict (1); Transmembrane (1)
Keywords Alternative splicing;Membrane;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 16299181; 17559508; 18315867; 18805951; 32354790;
Motif MOTIF 107..109; /note=GDS motif; MOTIF 333..347; /note=DCXHWCLPGXXDXWN motif
Gene Encoded By
Mass 40,111
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda