Detail Information for IndEnz0010001840
IED ID IndEnz0010001840
Enzyme Type ID esterase001840
Protein Name Protein trichome birefringence-like 21
Gene Name TBL21 At5g15890 F1N13.30
Organism Arabidopsis thaliana (Mouse-ear cress)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress)
Enzyme Sequence MELPLFAILQRTPRVAITLAFVLFVLTIVPALYTLLADPILPPSISSFETDHTRLSHLNSSSNQIPSPVNGSIPTPPYHTPSKHRKSSFHRIPKPKKGPISSPTDHIPLRQRSSSFDQIPSPMNSPVPAPPHRNSSADQSPSPVNGPIPAPLNHTSLRHLNSSSDDHSSPVTTSPSRTRIRDDEQMCDLFTGEWVPNEEAPYYTNTTCWAIHEHQNCMKYGRPDTGFMRWRWKPESCDLPIFDPQEFLEMVRGKAMGFVGDSISRNQVQSLLCLLSRVEYPEDISPSPDTDFKVWNYTSYNFTLHVMWSPFLVKATKPDPKSNFFSLYLDEYDTKWTSQLDQLDYLVISSGHWFSRPVIFYENQQISGCQYCALPNTTELPLTYGYRKALRISLKAIIENFKGLAFLRSFSPQHFEGGAWNEGGDCVRTQPYRRNETIPEADLKVHDIQREEFRAAEEDGMKKSGLRLKLMDTTQAMLLRPDGHPGRYGHLQNPNVTLRNDCIHWCLPGPIDTLNDILLQMMKTDN
Enzyme Length 526
Uniprot Accession Number Q9LFT1
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: May act as a bridging protein that binds pectin and other cell wall polysaccharides. Probably involved in maintaining esterification of pectins (By similarity). May be involved in the specific O-acetylation of cell wall polymers (By similarity). {ECO:0000250|UniProtKB:Q9FG35, ECO:0000250|UniProtKB:Q9LY46}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Compositional bias (2); Motif (2); Region (1); Transmembrane (1)
Keywords Membrane;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 16617098; 17665211; 22253603; 32354790;
Motif MOTIF 260..262; /note=GDS motif; MOTIF 501..515; /note=DCXHWCLPGXXDXWN motif
Gene Encoded By
Mass 59,866
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda