| IED ID | IndEnz0010001920 |
| Enzyme Type ID | esterase001920 |
| Protein Name |
Thrombin-like enzyme cerastotin SVTLE EC 3.4.21.- Fibrinogen-clotting enzyme Snake venom serine protease SVSP Fragment |
| Gene Name | |
| Organism | Cerastes cerastes (Horned desert viper) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Viperinae (vipers) Cerastes Cerastes cerastes (Horned desert viper) |
| Enzyme Sequence | VIGGAECNINEHRSLVLLYYSSRLFGGGTLINKEWVLSAAHCDGENMKIIYXXXXXXXXXXKDRQIRVAKKYFCRDRKKSVIDKDIMLIKKPVNGSTH |
| Enzyme Length | 98 |
| Uniprot Accession Number | P81038 |
| Absorption | |
| Active Site | ACT_SITE 41; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 85; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by PMSF. {ECO:0000269|PubMed:9249017}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease that preferentially cleaves the alpha-chain of fibrinogen (FGA). Induce platelet aggregation in the presence of exogenous fibrinogen. Possesses esterase and amidolytic activities. {ECO:0000269|PubMed:9249017}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Glycosylation (1); Non-terminal residue (1) |
| Keywords | Blood coagulation cascade activating toxin;Direct protein sequencing;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Platelet aggregation activating toxin;Protease;Secreted;Serine protease;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,168 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |