| IED ID | IndEnz0010001932 |
| Enzyme Type ID | esterase001932 |
| Protein Name |
Probable feruloyl esterase C EC 3.1.1.73 Ferulic acid esterase C |
| Gene Name | faeC AFUB_030150 |
| Organism | Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus) |
| Enzyme Sequence | MVPTIIYSAILALSAFTPSVFAQTRSSGCGKQPSLANGVHNINGREYILKVPDNYDKNKAHHLVFGLHWRGGNMWNIVDGQSIQPWYGLETRAQGSAIFVAPNGKNAGWANYGGEDIAFIDAIIKQVESDLCVDQSSRFATGFSWGGGMSYSLACSRAKQFKAVSVLSGGVISGCDGGNDPIAYLGIHGINDGVLPFQGGVNLAQKFVRNNGCQQSNVGTPQPGSRGSVRTDFKGCSKPVSFIAYDGGHDAAPLGVGSSLAPDATWRFFMAA |
| Enzyme Length | 272 |
| Uniprot Accession Number | B0XU32 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Feruloyl-polysaccharide + H(2)O = ferulate + polysaccharide.; EC=3.1.1.73; |
| DNA Binding | |
| EC Number | 3.1.1.73 |
| Enzyme Function | FUNCTION: Involved in degradation of plant cell walls. Hydrolyzes the feruloyl-arabinose ester bond in arabinoxylans, and the feruloyl-galactose ester bond in pectin. Active against paranitrophenyl-acetate, methyl ferulate and wheat arabinoxylan (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Hydrolase;Polysaccharide degradation;Secreted;Serine esterase;Signal;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,770 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |