| IED ID | IndEnz0011000004 |
| Enzyme Type ID | glucanase000004 |
| Protein Name |
Beta-glucanase EC 3.2.1.73 1,3-1,4-beta-D-glucan 4-glucanohydrolase Endo-beta-1,3-1,4 glucanase Lichenase |
| Gene Name | bg1 |
| Organism | Bacillus licheniformis |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus licheniformis |
| Enzyme Sequence | MSYRVKRMLMLLVTGLFLSLSTFAASASAQTGGSFYEPFNNYNTGLWQKADGYSNGNMFNCTWRANNVSMTSLGEMRLSLTSPSYNKFDCGENRSVQTYGYGLYEVNMKPAKNVGIVSSFFTYTGPTDGTPWDEIDIEFLGKDTTKVQFNYYTNGVGNHEKIVNLGFDAANSYHTYAFDWQPNSIKWYVDGQLKHTATTQIPQTPGKIMMNLWNGAGVDEWLGSYNGVTPLSRSLHWVRYTKR |
| Enzyme Length | 243 |
| Uniprot Accession Number | P27051 |
| Absorption | |
| Active Site | ACT_SITE 134; /note=Nucleophile; ACT_SITE 138; /note=Proton donor |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->4)-beta-D-glucosidic linkages in beta-D-glucans containing (1->3)- and (1->4)-bonds.; EC=3.2.1.73; |
| DNA Binding | |
| EC Number | 3.2.1.73 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (16); Chain (1); Disulfide bond (1); Domain (1); Helix (3); Mutagenesis (14); Sequence conflict (1); Signal peptide (1); Turn (2) |
| Keywords | 3D-structure;Disulfide bond;Glycosidase;Hydrolase;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1GBG; 3D6E; |
| Mapped Pubmed ID | 21069723; |
| Motif | |
| Gene Encoded By | |
| Mass | 27,435 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.2.1.73; |