| IED ID | IndEnz0011000051 |
| Enzyme Type ID | glucanase000051 |
| Protein Name |
Major allergen Alt a 1 allergen Alt a 1 |
| Gene Name | ALTA1 |
| Organism | Alternaria alternata (Alternaria rot fungus) (Torula alternata) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta dothideomyceta Dothideomycetes Pleosporomycetidae Pleosporales Pleosporineae Pleosporaceae Alternaria Alternaria sect. Alternaria Alternaria alternata complex Alternaria alternata (Alternaria rot fungus) (Torula alternata) |
| Enzyme Sequence | MQFTTIASLFAAAGLAAAAPLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS |
| Enzyme Length | 157 |
| Uniprot Accession Number | P79085 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May bind and inhibit the beta-glucanase activity of host plant thaumatin-like proteins. {ECO:0000269|PubMed:24642375}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (15); Chain (1); Disulfide bond (3); Domain (1); Helix (1); Signal peptide (1) |
| Keywords | 3D-structure;Allergen;Direct protein sequencing;Disulfide bond;Secreted;Signal |
| Interact With | P81370 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Spore wall {ECO:0000269|PubMed:22078468, ECO:0000269|PubMed:24642375}. Secreted {ECO:0000269|PubMed:22640235, ECO:0000269|PubMed:24642375, ECO:0000269|PubMed:8957113}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 3V0R; 4AUD; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,980 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |