| IED ID | IndEnz0011000054 |
| Enzyme Type ID | glucanase000054 |
| Protein Name |
Thaumatin-like protein Endo- 1,3 -beta-glucanase EC 3.2.1.- allergen Ole e 13 |
| Gene Name | |
| Organism | Olea europaea (Common olive) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Lamiales Oleaceae Oleeae Olea Olea europaea (Common olive) |
| Enzyme Sequence | MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQARIWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP |
| Enzyme Length | 226 |
| Uniprot Accession Number | E3SU11 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.2.1.- |
| Enzyme Function | FUNCTION: 3D-structure modeling suggests it may have endo-(1,3)-beta-glucanase activity. {ECO:0000305|PubMed:27017426}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (8); Signal peptide (1) |
| Keywords | Allergen;Direct protein sequencing;Disulfide bond;Hydrolase;Pathogenesis-related protein;Plant defense;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,727 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |