| IED ID | IndEnz0011000074 |
| Enzyme Type ID | glucanase000074 |
| Protein Name |
Glucan endo-1,3-beta-glucosidase, acidic isoform EC 3.2.1.39 1- 3 -beta-glucan endohydrolase 1- 3 -beta-glucanase Beta-1,3-endoglucanase Beta-1,3-glucanase 2 AtBG2 Pathogenesis-related protein 2 PR-2 |
| Gene Name | BG2 At3g57260 F28O9.110 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSESRSLASPPMLMILLSLVIASFFNHTAGQIGVCYGMLGDTLPSPSDVVALYKQQNIQRMRLYGPDPGALAALRGSDIELILDVPSSDLERLASSQTEADKWVQENVQSYRDGVRFRYINVGNEVKPSVGGFLLQAMQNIENAVSGAGLEVKVSTAIATDTTTDTSPPSQGRFRDEYKSFLEPVIGFLASKQSPLLVNLYPYFSYMGDTANIHLDYALFTAQSTVDNDPGYSYQNLFDANLDSVYAALEKSGGGSLEIVVSETGWPTEGAVGTSVENAKTYVNNLIQHVKNGSPRRPGKAIETYIFAMFDENKKEPTYEKFWGLFHPDRQSKYEVNFN |
| Enzyme Length | 339 |
| Uniprot Accession Number | P33157 |
| Absorption | |
| Active Site | ACT_SITE 125; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:O22317; ACT_SITE 263; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O22317 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans.; EC=3.2.1.39; |
| DNA Binding | |
| EC Number | 3.2.1.39 |
| Enzyme Function | FUNCTION: Implicated in the defense of plants against pathogens (Probable). Not involved in plasmodesmal callose degradation and in the gating of plasmodesmata during tobamovirus infection (PubMed:23656331). {ECO:0000269|PubMed:23656331, ECO:0000305|PubMed:1392589}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Frameshift (2); Sequence conflict (3); Signal peptide (1) |
| Keywords | Apoplast;Cell wall;Direct protein sequencing;Endoplasmic reticulum;Glycosidase;Hydrolase;Pathogenesis-related protein;Plant defense;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: By 2,6-dichloroisonicotinic acid (INA) and salicylic acid (possibly an endogenous signal for acquired resistance). Strongly induced by infection with the bacterial pathogen P.syringae pv. tomato DC3000 (PubMed:1392589). Induced by infection with avirulent and virulent strains of P.syringae pv. maculicola (PubMed:1824335). Induced by infection with the turnip vein clearing virus (TVCV) and cucumber mosaic virus (CMV) (PubMed:23656331). {ECO:0000269|PubMed:1392589, ECO:0000269|PubMed:1824335, ECO:0000269|PubMed:23656331}. |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum {ECO:0000269|PubMed:23656331}. Secreted, extracellular space, apoplast {ECO:0000269|PubMed:23656331}. Secreted, cell wall {ECO:0000269|PubMed:23656331}. Note=Exported in the apoplast and secreted to the cell wall under treatment with salicylic acid (SA). {ECO:0000269|PubMed:23656331}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..30; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10092183; 10449575; 10951693; 11069695; 11161062; 11309146; 11346966; 11971137; 12244227; 14765119; 15061088; 15539469; 15593128; 15634206; 15654638; 15879447; 15986925; 16048996; 16415066; 16574749; 16794326; 16941900; 16960394; 17189328; 17313162; 17419843; 17601164; 17990964; 18296723; 18321188; 18441339; 18538804; 18650403; 18798871; 18830970; 18849295; 18944926; 19432948; 19452453; 19466562; 19773385; 19809191; 19843314; 19947982; 20007779; 20347986; 20447269; 20456049; 20505369; 20508139; 20890619; 21198361; 21453430; 21670223; 21862480; 21974727; 22374398; 22564282; 22582100; 23070523; 23242136; 23297052; 23404561; 23624392; 23715470; 23728333; 23818851; 23952213; 23961939; 24047645; 24135942; 24834923; 25261123; 25627252; 25774162; 26029221; 26363358; 26941759; 27242694; 27806116; 28107453; 28351989; 28627464; 28910327; 28917191; 29119291; 29483147; 29719772; 29777502; 29868051; 29869942; 30083177; 30154809; 30408577; 30462256; 30480481; 30947022; 31507623; 31614458; 31632627; 31956325; 31969890; 32059380; 32218796; 32846118; 32910959; 7866028; 7889933; 7913642; 8281185; 8713620; 8713621; 8725243; 9634583; 9881167; 9927638; |
| Motif | |
| Gene Encoded By | |
| Mass | 37,339 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |